SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0005
         (609 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC1322.14c |vtc4||vacuolar transporter chaperone |Schizosaccha...    26   3.7  
SPAC13G6.12c |chs1|SPAC24B11.01c|chitin synthase I|Schizosacchar...    25   6.5  
SPCC1450.14c |ero12||ER oxidoreductin Ero1b|Schizosaccharomyces ...    25   8.7  

>SPCC1322.14c |vtc4||vacuolar transporter chaperone
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 721

 Score = 26.2 bits (55), Expect = 3.7
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%)
 Frame = +1

Query: 7   TSGSPRLAGNSAAGGSREK-ERETEYYLLSQNK*TMRNIKYKKY 135
           T GSP + G+SAAGG+++   R+T  Y +  N  T   I   K+
Sbjct: 174 TRGSP-IKGDSAAGGTQQNFVRQTTKYWVHPNNVTELKIYILKH 216


>SPAC13G6.12c |chs1|SPAC24B11.01c|chitin synthase
           I|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 859

 Score = 25.4 bits (53), Expect = 6.5
 Identities = 10/19 (52%), Positives = 15/19 (78%)
 Frame = +3

Query: 183 DKDHLETNHINITLTNILL 239
           +KD +ETNH+  T+TN+ L
Sbjct: 23  NKDIVETNHLYPTITNLSL 41


>SPCC1450.14c |ero12||ER oxidoreductin Ero1b|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 571

 Score = 25.0 bits (52), Expect = 8.7
 Identities = 17/46 (36%), Positives = 23/46 (50%)
 Frame = -3

Query: 451 AWTISQPIWY*VVTGTHRHLQRKCVTHLEI*VLRSRYSYNGCPTLQ 314
           AWT+ Q ++Y V++G H  +     THL    L  R    G P LQ
Sbjct: 249 AWTLEQRVFYRVLSGMHSSIS----THLCHGYLNQRNGVWG-PNLQ 289


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,574,713
Number of Sequences: 5004
Number of extensions: 52657
Number of successful extensions: 103
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 103
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 103
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 268287866
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).