SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0004
         (637 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr 2||...   140   2e-34
SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces pomb...    72   6e-14
SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex s...    66   3e-12
SPAC630.03 |arp3|act2|actin-like protein Arp3|Schizosaccharomyce...    66   5e-12
SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomy...    48   1e-06
SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces pombe...    42   1e-04
SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit Arp42|Sc...    39   7e-04
SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1...    30   0.32 
SPAC20G8.05c |cdc15||cell division control protein Cdc15|Schizos...    29   0.56 
SPCC622.02 |||dubious|Schizosaccharomyces pombe|chr 3|||Manual         28   1.3  
SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr...    27   1.7  
SPCC24B10.21 |tpi1|tpi|triosephosphate isomerase|Schizosaccharom...    27   2.3  
SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M...    27   3.0  
SPAC17A2.01 |bsu1|SPAC1B1.05, bsu1|high-affinity import carrier ...    27   3.0  
SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual    26   5.2  
SPCC1620.11 |mug87||nucleoporin Nic96 homolog|Schizosaccharomyce...    26   5.2  
SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit Arp9|Schizosa...    26   5.2  
SPAC637.06 |||alpha-1,2-galactosyltransferase |Schizosaccharomyc...    25   9.1  
SPAC1486.06 |||nicotinate phosphoribosyltransferase |Schizosacch...    25   9.1  

>SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 375

 Score =  140 bits (338), Expect = 2e-34
 Identities = 71/129 (55%), Positives = 79/129 (61%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRH G+MVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHHGIMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P++   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPCLLTEAPLNPKSNREKMTQ 121

Query: 432 IMFETFNTP 458
           I+FETFN P
Sbjct: 122 IIFETFNAP 130



 Score =  119 bits (286), Expect = 4e-28
 Identities = 51/58 (87%), Positives = 53/58 (91%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPCLLTEAPLNPKSNREK 118


>SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 379

 Score = 72.1 bits (169), Expect = 6e-14
 Identities = 44/135 (32%), Positives = 62/135 (45%), Gaps = 1/135 (0%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           + +DNGSG  KAGFAGDD P+ +FP+ VGR +H+ VM    QKD +VG EAQ+ R     
Sbjct: 12  ICIDNGSGFIKAGFAGDDIPKCLFPTCVGRIKHERVMPSSIQKDMFVGSEAQNLRGLLKI 71

Query: 270 XXXXXXXXXLTGMTWRR-FGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFET 446
                             +  I S     + P      L   P      + K+ +  +ET
Sbjct: 72  QRPIERGIIQNWSDMEEIWSYIYSDQQLNTLPEEHPLLLTEPPLANIRNKEKIAEYFYET 131

Query: 447 FNTPRHVRLAFKPVL 491
            N P  +  + +PVL
Sbjct: 132 LNVPA-LSFSLQPVL 145


>SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex
           subunit Arp2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 390

 Score = 66.5 bits (155), Expect = 3e-12
 Identities = 24/57 (42%), Positives = 43/57 (75%)
 Frame = +2

Query: 251 KSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           +S+L +KYP+E+GI+ ++++M ++W +TF+ +L++ P    +LLTE  +NP  NREK
Sbjct: 62  RSLLQVKYPMENGIIRDFEEMNQLWDYTFFEKLKIDPRGRKILLTEPPMNPVANREK 118



 Score = 58.8 bits (136), Expect = 6e-10
 Identities = 41/126 (32%), Positives = 54/126 (42%), Gaps = 2/126 (1%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSK 251
           E A +V+DNG+G  K G+A D+ PR  FPSIVGRP  R +     +  KD  VGDEA++ 
Sbjct: 2   ESAPIVLDNGTGFVKVGYAKDNFPRFQFPSIVGRPILRAEEKTGNVQIKDVMVGDEAEAV 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             PR  +  L   P  P A   KM +
Sbjct: 62  RSLLQVKYPMENGIIRDFEEMNQLWDYTFFEKLKIDPRGRKILLTEPPMNPVANREKMCE 121

Query: 432 IMFETF 449
            MFE +
Sbjct: 122 TMFERY 127


>SPAC630.03 |arp3|act2|actin-like protein Arp3|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 427

 Score = 65.7 bits (153), Expect = 5e-12
 Identities = 27/52 (51%), Positives = 33/52 (63%)
 Frame = +2

Query: 263 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           +L YPI HG + NWD ME+ W  + +  LR  PE+H  LLTE  LNP  NRE
Sbjct: 89  SLDYPIRHGQIENWDHMERFWQQSLFKYLRCEPEDHYFLLTEPPLNPPENRE 140



 Score = 42.7 bits (96), Expect = 4e-05
 Identities = 20/52 (38%), Positives = 32/52 (61%), Gaps = 2/52 (3%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG--MGQKDSYVGDE 239
           +++DNG+G  K G+AG+DAP  VFP+++   R  G   G  +  K SY+  +
Sbjct: 8   IIMDNGTGYSKLGYAGNDAPSYVFPTVIA-TRSAGASSGPAVSSKPSYMASK 58


>SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 433

 Score = 48.0 bits (109), Expect = 1e-06
 Identities = 21/54 (38%), Positives = 30/54 (55%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           + +K  I +G V NWD    +W +    +L+  P EHP+L+TE   NP  NR K
Sbjct: 63  MEIKNAIRNGWVENWDVTVDLWRYGLEQQLKTNPLEHPILITEPFDNPPENRVK 116



 Score = 40.3 bits (90), Expect = 2e-04
 Identities = 16/34 (47%), Positives = 24/34 (70%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 176
           +EV+A+V+D GS   + GF+G+D P+ V PS  G
Sbjct: 9   DEVSAIVIDPGSKWTRIGFSGEDIPKCVLPSYCG 42


>SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 721

 Score = 41.5 bits (93), Expect = 1e-04
 Identities = 17/43 (39%), Positives = 27/43 (62%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNP 403
           P E  +++NWD ME++  +TF  +L +   EHP+ +TE   NP
Sbjct: 86  PFERNVISNWDLMEQVLDYTFL-KLGIDRMEHPICMTEPLANP 127



 Score = 35.9 bits (79), Expect = 0.005
 Identities = 15/32 (46%), Positives = 22/32 (68%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 185
           LV+DNGS   +AG+ G+  P+ VF ++V R R
Sbjct: 27  LVIDNGSWQLRAGWGGEKDPKLVFDNLVSRYR 58


>SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit
           Arp42|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 430

 Score = 38.7 bits (86), Expect = 7e-04
 Identities = 20/57 (35%), Positives = 33/57 (57%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           EE+ +LV+D GS   + G+AG+++P  + PS      + GV   +  ++ YV DE Q
Sbjct: 8   EEIPSLVIDPGSCWTRFGYAGEESPMTILPS------YYGVRSDVTGRNKYVVDELQ 58



 Score = 37.1 bits (82), Expect = 0.002
 Identities = 14/46 (30%), Positives = 27/46 (58%)
 Frame = +2

Query: 284 HGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           +GI+ +W+     W      +L+V P E+ +++TE S NP+  R++
Sbjct: 74  NGIIQDWESTLYTWERGLKEKLQVNPTEYAMMITEPSWNPQSVRQQ 119


>SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 800

 Score = 29.9 bits (64), Expect = 0.32
 Identities = 19/55 (34%), Positives = 23/55 (41%), Gaps = 1/55 (1%)
 Frame = -1

Query: 232 PT*ESFCPI-PTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSS 71
           PT  S  P+ PT+ P     P    N     S P         PL+TTN  TS+S
Sbjct: 401 PTGNSTTPVTPTVPPTSSSTPLTTTNCTTSTSVPYTSTPVTSTPLATTNCTTSTS 455


>SPAC20G8.05c |cdc15||cell division control protein
           Cdc15|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 927

 Score = 29.1 bits (62), Expect = 0.56
 Identities = 15/40 (37%), Positives = 19/40 (47%)
 Frame = -2

Query: 273 YLRVRILFCSVPHLLHKSPSVPYRPSRPDGGAFPRSRGTR 154
           Y +   L   +  L+ K+PS PY  SRP   A   S  TR
Sbjct: 296 YFKENGLNYDIDQLISKAPSYPYSSSRPSASASLASSPTR 335


>SPCC622.02 |||dubious|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 127

 Score = 27.9 bits (59), Expect = 1.3
 Identities = 23/58 (39%), Positives = 28/58 (48%)
 Frame = -3

Query: 266 GSGYSFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHTGAIVYY 93
           G G +F  CLI++IR  +SH            D  EHG   II C T L   G I+YY
Sbjct: 49  GLGIAFIYCLIAFIRE-MSHPSSR-------KDTMEHGL-PIILCST-LMLVGNILYY 96


>SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1517

 Score = 27.5 bits (58), Expect = 1.7
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = +3

Query: 135 GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           G+  PRA F  ++  P H G+++ M  KD   G+E  S +
Sbjct: 502 GNQNPRATFVPLLCLPEHGGMVISM--KDWIGGEEFMSPK 539


>SPCC24B10.21 |tpi1|tpi|triosephosphate
           isomerase|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 249

 Score = 27.1 bits (57), Expect = 2.3
 Identities = 10/33 (30%), Positives = 16/33 (48%)
 Frame = -2

Query: 609 WGKSGVSLSVKWGTGCGKTPVPGKSQHEYRVVR 511
           W K  ++    W  G GKT  P ++Q  +  +R
Sbjct: 157 WSKIVIAYEPVWAIGTGKTATPEQAQEVHAEIR 189


>SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 309

 Score = 26.6 bits (56), Expect = 3.0
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 2/41 (4%)
 Frame = -1

Query: 235 SPT*ESFC--PIPTITP*WRGLPTIEGNTARGASSPAKPAL 119
           S T +SF   P+PT  P    LPT   NT +    P+ PAL
Sbjct: 64  SNTPKSFAAPPVPTGAP---SLPTSSNNTQQAEERPSMPAL 101


>SPAC17A2.01 |bsu1|SPAC1B1.05, bsu1|high-affinity import carrier for
           pyridoxine, pyridoxal, and pyridoxamine
           Bsu1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 526

 Score = 26.6 bits (56), Expect = 3.0
 Identities = 20/69 (28%), Positives = 30/69 (43%)
 Frame = -1

Query: 520 GGTDGRRTARSTGLNAKRTWRGVLNVSNMIWVIFLSVALGVEGSLSKQDWVFLGGDTQLI 341
           GG  G   A    +NAK  WR +  ++ ++   FL V L +  +L  +           I
Sbjct: 217 GGAIGAPMATGVDINAKYGWRWLYYINIIVGGFFLIVILIIPETLPIKVITRYENAKGRI 276

Query: 340 VEGMMPNLL 314
           VEG+  N L
Sbjct: 277 VEGIPKNNL 285


>SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1828

 Score = 25.8 bits (54), Expect = 5.2
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = -2

Query: 117 TYRSHCLLPTRQLLRRTS*ISEI 49
           TYR H  +PT  LL  T  +SEI
Sbjct: 168 TYRDHDAIPTATLLNPTLDVSEI 190


>SPCC1620.11 |mug87||nucleoporin Nic96 homolog|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 851

 Score = 25.8 bits (54), Expect = 5.2
 Identities = 10/33 (30%), Positives = 18/33 (54%)
 Frame = -1

Query: 538 VPARIPGGTDGRRTARSTGLNAKRTWRGVLNVS 440
           VP    G T        +G+NA++TW+ + ++S
Sbjct: 55  VPTSKDGNTKAHYLLAGSGINAEQTWKKIESLS 87


>SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit
           Arp9|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 523

 Score = 25.8 bits (54), Expect = 5.2
 Identities = 7/21 (33%), Positives = 13/21 (61%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTF 337
           PI+ G V +W+ ++  W H +
Sbjct: 113 PIQRGRVVDWEALKAFWKHLY 133


>SPAC637.06 |||alpha-1,2-galactosyltransferase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 347

 Score = 25.0 bits (52), Expect = 9.1
 Identities = 10/19 (52%), Positives = 11/19 (57%)
 Frame = +3

Query: 510 SVPPGIRAGTSREPVFFHN 566
           S PPG  AG    P FF+N
Sbjct: 286 SYPPGACAGEGENPRFFYN 304


>SPAC1486.06 |||nicotinate phosphoribosyltransferase
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 410

 Score = 25.0 bits (52), Expect = 9.1
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 571 HGLWKNTGSREVP 533
           HGLWKNT   E+P
Sbjct: 115 HGLWKNTIFYEIP 127


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,069,366
Number of Sequences: 5004
Number of extensions: 72982
Number of successful extensions: 215
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 187
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 211
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 283719918
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).