SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0002
         (607 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyce...    28   1.2  
SPAC343.06c |||scramblase|Schizosaccharomyces pombe|chr 1|||Manual     28   1.2  
SPAC22A12.08c |||cardiolipin synthase/ hydrolase fusion protein ...    26   3.7  
SPAP14E8.04 |oma1||metallopeptidase Oma1 |Schizosaccharomyces po...    26   4.9  
SPBC25B2.03 |||zf-C3HC4 type zinc finger|Schizosaccharomyces pom...    25   8.6  

>SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 1610

 Score = 27.9 bits (59), Expect = 1.2
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 2/61 (3%)
 Frame = +1

Query: 82  NVVDWNYPDQFSKQQALRT-GALIPENALPVGIERW-RNKLFVSVPRWRSGIPATLNYIP 255
           +++ WN P QF  +Q L     L P   L + +ER  R K+FV +    S +   L   P
Sbjct: 74  DLIQWNDPSQFDNEQFLNALAVLFPR--LSIEVERHVRLKIFVFMSVLSSALQKKL--AP 129

Query: 256 W 258
           W
Sbjct: 130 W 130


>SPAC343.06c |||scramblase|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 381

 Score = 27.9 bits (59), Expect = 1.2
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +1

Query: 352 IQGSKQTSVIVFGYLDVWHLWIRQRYQM 435
           I  SK +S +V   L  WHLW R+RY++
Sbjct: 167 IDYSKFSSTLVGEVLQKWHLW-RRRYEL 193


>SPAC22A12.08c |||cardiolipin synthase/ hydrolase fusion protein
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 570

 Score = 26.2 bits (55), Expect = 3.7
 Identities = 10/24 (41%), Positives = 16/24 (66%)
 Frame = +2

Query: 512 VYRPRKENLFFLPNFLIWANNLGS 583
           + RP +EN+F LPN L ++  L +
Sbjct: 390 IQRPLRENIFTLPNLLTFSRLLSA 413


>SPAP14E8.04 |oma1||metallopeptidase Oma1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 337

 Score = 25.8 bits (54), Expect = 4.9
 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 2/30 (6%)
 Frame = -3

Query: 143 APVL--RACCFENWSG*FQSTTFHENISWS 60
           APVL  + C + N++G  Q+     N+SWS
Sbjct: 19  APVLSYKKCSYRNFNGLLQARFQSNNLSWS 48


>SPBC25B2.03 |||zf-C3HC4 type zinc finger|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 554

 Score = 25.0 bits (52), Expect = 8.6
 Identities = 10/16 (62%), Positives = 13/16 (81%)
 Frame = +3

Query: 267 YEPSPKLTPYPSFEGN 314
           Y+P+PKLTP+ SF  N
Sbjct: 221 YKPNPKLTPF-SFNNN 235


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,737,058
Number of Sequences: 5004
Number of extensions: 59265
Number of successful extensions: 147
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 143
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 147
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 266270664
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).