BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_D02_e12_08.seq (1515 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC890.08 |rpl31||60S ribosomal protein L31|Schizosaccharomyces... 115 1e-26 SPAC56F8.05c |mug64||conserved fungal protein|Schizosaccharomyce... 28 3.9 >SPAC890.08 |rpl31||60S ribosomal protein L31|Schizosaccharomyces pombe|chr 1|||Manual Length = 113 Score = 115 bits (277), Expect = 1e-26 Identities = 57/102 (55%), Positives = 73/102 (71%) Frame = +2 Query: 131 KSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRRFAEKQMGTPDVRVDTRLNKYLW 310 KSAIN+VVTR+YT+++HKRL+GV FKKRAPRAIKEI FA+K M T +VRVD LNK +W Sbjct: 6 KSAINQVVTRDYTIHMHKRLYGVSFKKRAPRAIKEIVAFAQKHMQTKEVRVDPSLNKEVW 65 Query: 311 SKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIK 436 +G+RNVP +D++D A L+T V V VA+ K Sbjct: 66 KRGIRNVPHRLRLRLSRKRSDEDDKA--LYTYVQAVDVANPK 105 >SPAC56F8.05c |mug64||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 295 Score = 27.9 bits (59), Expect = 3.9 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +1 Query: 577 FYNVVTGKTLALPNLIALQHIPLSASWRNSEEAR-TDRPSQXL 702 F V+GK L NL L+ PL++ +N EE +PS+ L Sbjct: 98 FGKTVSGKVRNLGNLTPLEQTPLASVGKNLEEKEAAAKPSRTL 140 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,779,242 Number of Sequences: 5004 Number of extensions: 61782 Number of successful extensions: 107 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 107 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 848370472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -