BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30102 (734 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0168 + 28122429-28122650,28122651-28122725,28123066-281231... 28 8.8 05_04_0118 - 18162934-18162982,18163246-18163357,18163583-18163622 28 8.8 >05_07_0168 + 28122429-28122650,28122651-28122725,28123066-28123122, 28123248-28123411,28123672-28123806,28123908-28124010, 28124165-28124264,28124348-28124556 Length = 354 Score = 27.9 bits (59), Expect = 8.8 Identities = 16/54 (29%), Positives = 23/54 (42%) Frame = +3 Query: 516 PDGFSFGYETDNGISAQSSGSLKKVDNIDVLAIQGQYEYSAPDGTPVKFTYTAD 677 P FSFGY T +S S ++ ++ +D L Q E G + F D Sbjct: 201 PFSFSFGYHTYLSVSDISEVRIEGLETLDYLDNLSQRERFTEQGDAITFESEVD 254 >05_04_0118 - 18162934-18162982,18163246-18163357,18163583-18163622 Length = 66 Score = 27.9 bits (59), Expect = 8.8 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 6/42 (14%) Frame = +2 Query: 68 RFQLSGNSGRKHSRCCTSILRKFSGR------QHCVTVDCCC 175 R +G+K RCC S R+ + R + C+ CCC Sbjct: 17 RLDSEQQAGKKKGRCCGSSCRRSTKRGETSFIEGCIAALCCC 58 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,564,619 Number of Sequences: 37544 Number of extensions: 382861 Number of successful extensions: 877 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 851 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 877 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1933531792 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -