BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30090 (820 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1344 - 29472139-29473292,29474478-29475386,29475504-294756... 30 2.5 04_02_0001 + 8403210-8403468,8404659-8405110 29 4.4 >06_03_1344 - 29472139-29473292,29474478-29475386,29475504-29475618, 29476017-29476218,29477177-29477296,29477431-29477582, 29478177-29478461 Length = 978 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +3 Query: 447 MPTDLSMSASEPWRKRARSDTRPHRRRQRNMTNIGSVRLSEI 572 +P LS S E R R R HR+++RN+T S SE+ Sbjct: 379 LPESLSDSKVEVGRDTRRHQKREHRKKKRNITESESSSDSEV 420 >04_02_0001 + 8403210-8403468,8404659-8405110 Length = 236 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -3 Query: 191 IPHNLASPAGSTILNTPVSLFFHAI 117 IPH+LAS + T+LN +LFF I Sbjct: 107 IPHSLASSSSLTVLNLTNNLFFGTI 131 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,320,884 Number of Sequences: 37544 Number of extensions: 392317 Number of successful extensions: 871 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 840 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 871 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2244686244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -