SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30060
         (824 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_04_0255 + 19462668-19462695,19463443-19464491                      105   4e-23
01_06_1721 - 39426957-39428005,39428812-39428839                      105   6e-23
06_03_0718 + 23840198-23840409,23841368-23841518,23842190-238422...   103   2e-22
08_01_0142 - 1121762-1122822,1123087-1123114                           96   3e-20
11_01_0448 - 3469398-3469676,3470015-3470284,3470386-3470476,347...    95   5e-20
12_01_0448 + 3537661-3538018,3538920-3539047,3539740-3539763,354...    70   2e-12
11_04_0182 - 14597325-14597881,14598082-14598243,14598416-14598950     35   0.068
01_01_0360 - 2837046-2837507                                           34   0.12 
01_01_0364 - 2856598-2857059                                           34   0.16 
01_01_0362 - 2843659-2844468,2844669-2844699,2844824-2844903,284...    34   0.16 
07_03_1705 + 28848293-28848321,28848766-28848841,28848940-288490...    32   0.64 
06_01_0093 - 776567-777335,777449-777747                               32   0.64 
05_02_0156 + 7163756-7163834,7165447-7166225                           32   0.64 
01_01_0331 + 2685802-2686263                                           32   0.64 
01_01_0329 + 2673479-2673940                                           32   0.64 
10_06_0002 + 9382559-9382937,9383008-9383180,9386752-9386901,938...    31   1.1  
03_01_0096 + 763850-764027,764873-765189,765262-765433,765513-76...    31   1.5  
07_03_0943 - 22778877-22780970,22781376-22781480,22781481-227820...    30   1.9  
04_01_0610 - 7997406-7998047,7998379-7998426,8000719-8001143,800...    30   1.9  
01_01_0366 + 2871188-2871655                                           30   1.9  
01_04_0072 - 15721866-15723563                                         30   2.6  
01_04_0070 - 15704794-15706491                                         30   2.6  
03_02_0367 + 7834072-7834479,7834555-7834779,7834858-7835082,783...    29   3.4  
12_02_0167 - 14824241-14824279,14824385-14824423,14824509-148247...    29   4.5  
08_01_0410 + 3661304-3661383,3661494-3661673,3661757-3661870,366...    29   4.5  
04_01_0347 - 4546566-4546604,4546710-4546748,4546834-4547059,454...    29   4.5  
03_02_0119 - 5725588-5726688,5726793-5726894                           29   4.5  
11_03_0006 + 8878611-8878724,8879323-8879706                           29   5.9  
06_02_0114 + 11991474-11991679,11997469-11998024,11998103-119985...    28   7.8  
06_01_0965 - 7430019-7430393,7430914-7431180,7431599-7431759,743...    28   7.8  
02_05_0466 + 29278009-29278575                                         28   7.8  
01_01_0516 + 3778891-3779069,3779436-3779541,3780526-3780888           28   7.8  

>05_04_0255 + 19462668-19462695,19463443-19464491
          Length = 358

 Score =  105 bits (252), Expect = 4e-23
 Identities = 46/76 (60%), Positives = 58/76 (76%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           +SGVILF ETLYQK  DG P V +L++ G++PGIKVDKG + + G+E E TTQG DDL +
Sbjct: 69  LSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVAGTEKETTTQGHDDLGK 128

Query: 458 RCAQYKKDGCHFAKWR 505
           RCA+Y + G  FAKWR
Sbjct: 129 RCAKYYEAGARFAKWR 144



 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 34/52 (65%), Positives = 38/52 (73%)
 Frame = +3

Query: 96  QEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLF 251
           ++EL K A  I  P KGILAADESTGT+GKR   I VEN EENRR  R+LLF
Sbjct: 9   KDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRSLRELLF 60


>01_06_1721 - 39426957-39428005,39428812-39428839
          Length = 358

 Score =  105 bits (251), Expect = 6e-23
 Identities = 46/78 (58%), Positives = 59/78 (75%)
 Frame = +2

Query: 272 ENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDL 451
           +++SGVILF ETLYQK  DG P V +L++ G++PGIKVDKG V + G+  E TTQG DDL
Sbjct: 67  QHLSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTVEVAGTNKETTTQGHDDL 126

Query: 452 AQRCAQYKKDGCHFAKWR 505
            +RCA+Y + G  FAKWR
Sbjct: 127 GKRCAKYYEAGARFAKWR 144



 Score = 68.1 bits (159), Expect = 8e-12
 Identities = 34/53 (64%), Positives = 39/53 (73%)
 Frame = +3

Query: 96  QEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           ++EL K A  I  P KGILAADESTGT+GKR   I VEN EENRR  R+LLF+
Sbjct: 9   KDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRSLRELLFT 61


>06_03_0718 +
           23840198-23840409,23841368-23841518,23842190-23842294,
           23843476-23843608,23844164-23844849,23844937-23845299
          Length = 549

 Score =  103 bits (246), Expect = 2e-22
 Identities = 54/122 (44%), Positives = 72/122 (59%), Gaps = 1/122 (0%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           +SGVILF ETLYQ    GTP V +L+  G++PGIKVDKG V + G+  E TTQGLD L  
Sbjct: 260 LSGVILFEETLYQSTAAGTPFVDVLKAGGVVPGIKVDKGTVDIAGTNGETTTQGLDSLGA 319

Query: 458 RCAQYKKDGCHFAKWRCC*R-SAATPPRTKLSRKTPMFLARLRFHLSEPTHSCRLLKPEV 634
           RCA+Y + G  FAKWR   +  AA  P     ++    LAR    + +      +++PE+
Sbjct: 320 RCAKYYEAGARFAKWRAVLKIGAAGEPSELAVKQNAEGLARYAL-ICQENGLVPIVEPEI 378

Query: 635 FT 640
            T
Sbjct: 379 LT 380



 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 33/51 (64%), Positives = 38/51 (74%)
 Frame = +3

Query: 102 ELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           EL K A+ I  P KGILAADESTGT+GKRL  I VEN E NR+  R+LLF+
Sbjct: 202 ELIKTAKYIATPGKGILAADESTGTIGKRLASINVENVEPNRQALRELLFT 252


>08_01_0142 - 1121762-1122822,1123087-1123114
          Length = 362

 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/76 (57%), Positives = 52/76 (68%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           +SGVILF ETLYQ   DGTP V +L   G++ GIKVDKG V L G++ E TTQG D L +
Sbjct: 69  LSGVILFEETLYQSTRDGTPFVDVLAAAGVLAGIKVDKGTVELAGTDRETTTQGHDGLGE 128

Query: 458 RCAQYKKDGCHFAKWR 505
           RC +Y   G  FAKWR
Sbjct: 129 RCRRYYAAGARFAKWR 144



 Score = 70.9 bits (166), Expect = 1e-12
 Identities = 35/53 (66%), Positives = 41/53 (77%)
 Frame = +3

Query: 96  QEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           ++EL + A  I  P KGILAADESTGT+GKRL  IGVEN EENRR  R+LLF+
Sbjct: 9   KDELIRNAAYIGTPGKGILAADESTGTIGKRLASIGVENVEENRRALRELLFT 61


>11_01_0448 -
           3469398-3469676,3470015-3470284,3470386-3470476,
           3470581-3470690,3470867-3471136,3471768-3471914
          Length = 388

 Score = 95.5 bits (227), Expect = 5e-20
 Identities = 46/80 (57%), Positives = 55/80 (68%)
 Frame = +2

Query: 266 LSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLD 445
           L + ISG ILF ETLYQ   DG  +V +L ++ I+PGIKVDKG+VPL GS +E   QGLD
Sbjct: 98  LGQYISGAILFEETLYQSTVDGKKIVDILTEQKIVPGIKVDKGLVPLAGSNNESWCQGLD 157

Query: 446 DLAQRCAQYKKDGCHFAKWR 505
            LA R A Y + G  FAKWR
Sbjct: 158 GLASREAAYYQQGARFAKWR 177



 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 30/50 (60%), Positives = 36/50 (72%)
 Frame = +3

Query: 99  EELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLL 248
           +EL K A+ I +P +GILA DES  T GKRL  IG+ENTE NR+ YR LL
Sbjct: 43  DELVKTAKTIASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLL 92


>12_01_0448 +
           3537661-3538018,3538920-3539047,3539740-3539763,
           3542051-3542317,3542994-3543530
          Length = 437

 Score = 70.1 bits (164), Expect = 2e-12
 Identities = 33/59 (55%), Positives = 41/59 (69%)
 Frame = +2

Query: 266 LSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGL 442
           L + ISG ILF ETLYQ   DG  +V +L ++GI+PGI VDKG+VPL GS+ E    GL
Sbjct: 205 LGQYISGAILFEETLYQSTVDGRRIVDVLAEQGIVPGINVDKGLVPLAGSDPESLEDGL 263


>11_04_0182 - 14597325-14597881,14598082-14598243,14598416-14598950
          Length = 417

 Score = 35.1 bits (77), Expect = 0.068
 Identities = 22/72 (30%), Positives = 33/72 (45%)
 Frame = +2

Query: 131 SSRKGYPRR*RIHRYNGKAFAGHRRGEHRGEPSSLSPTPIQPDAVLSENISGVILFHETL 310
           ++R G P         G+  + H R   +G P +  P P      L+E  S VIL H+ L
Sbjct: 229 TTRGGNPEDPHQRAIIGRNASAHLRTLSKGHPCNKRPLPTTKLVKLTEECSNVIL-HKLL 287

Query: 311 YQKADDGTPLVS 346
            +K D G P ++
Sbjct: 288 EKKKDPGCPTIT 299


>01_01_0360 - 2837046-2837507
          Length = 153

 Score = 34.3 bits (75), Expect = 0.12
 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 1/55 (1%)
 Frame = -1

Query: 356 SPAGR-PEAFHRQPSGKGSRGTGSHQRCSRRAQRQAE*ELAITTTVLLCVLHADV 195
           +PAG+ P+A  R P+GKG +G+G  ++  R+  +++     I    +L  +H D+
Sbjct: 27  APAGKKPKAEKRLPAGKGEKGSGEGKKAGRKKAKKSVETYKIYIFKVLKQVHPDI 81


>01_01_0364 - 2856598-2857059
          Length = 153

 Score = 33.9 bits (74), Expect = 0.16
 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 1/55 (1%)
 Frame = -1

Query: 356 SPAGR-PEAFHRQPSGKGSRGTGSHQRCSRRAQRQAE*ELAITTTVLLCVLHADV 195
           +PAG+ P+A  R P+GKG +G+G  ++  R+  +++     I    +L  +H D+
Sbjct: 27  APAGKKPKAEKRLPAGKGEKGSGEGKKAGRKKGKKSVETYKIYIFKVLKQVHPDI 81


>01_01_0362 -
           2843659-2844468,2844669-2844699,2844824-2844903,
           2846680-2847831
          Length = 690

 Score = 33.9 bits (74), Expect = 0.16
 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 1/55 (1%)
 Frame = -1

Query: 356 SPAGR-PEAFHRQPSGKGSRGTGSHQRCSRRAQRQAE*ELAITTTVLLCVLHADV 195
           +PAG+ P+A  R P+GKG +G+G  ++  R+  +++     I    +L  +H D+
Sbjct: 564 APAGKKPKAEKRLPAGKGEKGSGEGKKAGRKKGKKSVETYKIYIFKVLKQVHPDI 618


>07_03_1705 +
           28848293-28848321,28848766-28848841,28848940-28849082,
           28849297-28849383,28849492-28849575,28850224-28850380,
           28850521-28850606,28850995-28851226,28851351-28851471,
           28851610-28851746,28852086-28852202,28852612-28852660,
           28852751-28852793,28852945-28853116,28853192-28853262,
           28853365-28853458,28853608-28853820,28853851-28853859,
           28853895-28853999,28854266-28854586,28854664-28854789
          Length = 823

 Score = 31.9 bits (69), Expect = 0.64
 Identities = 14/39 (35%), Positives = 22/39 (56%)
 Frame = +2

Query: 374 GIKVDKGVVPLFGSEDECTTQGLDDLAQRCAQYKKDGCH 490
           G+ ++  V    GS+ EC  + LD+L      YKK+GC+
Sbjct: 782 GVSLEDVVKHFNGSKRECVVEMLDNLEGNFLVYKKNGCY 820


>06_01_0093 - 776567-777335,777449-777747
          Length = 355

 Score = 31.9 bits (69), Expect = 0.64
 Identities = 13/25 (52%), Positives = 18/25 (72%)
 Frame = -3

Query: 438 PWVVHSSSDPNSGTTPLSTLMPGMM 364
           P+  HSSSDP S + PL +L+P M+
Sbjct: 67  PYSHHSSSDPMSASNPLVSLLPAMV 91


>05_02_0156 + 7163756-7163834,7165447-7166225
          Length = 285

 Score = 31.9 bits (69), Expect = 0.64
 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 1/45 (2%)
 Frame = +1

Query: 367 HPRHQGRQGCRPAVRIGRRM-HHPGSGRPRPALRPVQEGRLPLRQ 498
           HPRH+ R+   P  R  R + H    G P PALRP    RLP R+
Sbjct: 96  HPRHRRRRAAPPRPRRLRPVGHRKAPGDPLPALRP---RRLPGRR 137


>01_01_0331 + 2685802-2686263
          Length = 153

 Score = 31.9 bits (69), Expect = 0.64
 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = -1

Query: 356 SPAGR-PEAFHRQPSGKGSRGTGSHQRCSRRAQRQAE*ELAITTTVLLCVLHADV 195
           +PAG+ P+A  R P+GK  +G+G  ++  R+  +++     I    +L  +H D+
Sbjct: 27  APAGKKPKAEKRLPAGKAEKGSGEGKKAGRKKAKKSVETYKIYIFKVLKQVHPDI 81


>01_01_0329 + 2673479-2673940
          Length = 153

 Score = 31.9 bits (69), Expect = 0.64
 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = -1

Query: 356 SPAGR-PEAFHRQPSGKGSRGTGSHQRCSRRAQRQAE*ELAITTTVLLCVLHADV 195
           +PAG+ P+A  R P+GK  +G+G  ++  R+  +++     I    +L  +H D+
Sbjct: 27  APAGKKPKAEKRLPAGKAEKGSGEGRKAGRKKAKKSVETYKIYIFKVLKQVHPDI 81


>10_06_0002 +
           9382559-9382937,9383008-9383180,9386752-9386901,
           9387180-9387325,9387416-9387572,9387720-9387778,
           9388204-9388360,9389001-9389150,9389280-9389416,
           9390071-9390217,9390292-9390393,9390742-9390799,
           9391997-9392034,9392124-9392250,9392320-9392493,
           9393125-9393256,9393940-9394049,9394752-9394812,
           9395036-9395213,9395326-9395531,9395796-9395915,
           9396496-9396594,9396983-9397204,9397482-9397621,
           9397741-9397852,9398021-9398071,9398151-9398240,
           9398397-9398567,9398663-9398815,9399774-9399950,
           9400045-9400182,9400295-9400365,9400739-9400838,
           9401324-9401380,9401469-9401525,9401619-9401699,
           9401782-9401864,9401975-9402110
          Length = 1632

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 24/86 (27%), Positives = 32/86 (37%)
 Frame = -1

Query: 524 RPIFSSNATWRSGSRPSCTGRSAGRGRPDPGWCIRLPIRTAXXXXXXXXXXXXXPSSPAG 345
           RP  + +A WR G RP+ T    GR + +  W    P+  A              S+ AG
Sbjct: 24  RPWTAKDARWRGGQRPAATPADEGRSQ-EAAW----PV--APWACGERQAGGTRESAAAG 76

Query: 344 RPEAFHRQPSGKGSRGTGSHQRCSRR 267
            P A       +G R  G      RR
Sbjct: 77  EPRAGEGPGGWEGRRSGGGRAPARRR 102


>03_01_0096 +
           763850-764027,764873-765189,765262-765433,765513-765586,
           765658-765835,765917-766026,766122-766221,766305-766391,
           766505-766681,766847-767120,767201-767362,767450-767665,
           767744-767781,768044-768102,768214-768339,768415-768540,
           768642-768695,768789-768851,768924-768986,769079-769141,
           769232-769732
          Length = 1045

 Score = 30.7 bits (66), Expect = 1.5
 Identities = 15/59 (25%), Positives = 27/59 (45%)
 Frame = +2

Query: 509 C*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCRLLKPEVFT*WAKHEPWNRAPERL 685
           C R +A    + L  +T   +++    + E T+ C +   E +  W+  E  N+  ERL
Sbjct: 234 CKRCSAHTGNSPLQTRTSKLISKYEKQIEELTNQCNMKSDECYMAWSSVESTNQELERL 292


>07_03_0943 -
           22778877-22780970,22781376-22781480,22781481-22782059,
           22782149-22782187,22782340-22782372
          Length = 949

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 23/79 (29%), Positives = 33/79 (41%), Gaps = 2/79 (2%)
 Frame = -3

Query: 564 IGVFLDSLVRGGVAADLQQQRHLAKWQPSFLYWAQRWAR-SSRPWVVHSSSDPN-SGTTP 391
           IG    SL  G +   L     L+K + + L+W   W R  +R W      D +  G   
Sbjct: 314 IGKACSSLSSGDIIKFLTGDFRLSKAKSNDLFWEAVWPRLLARGWHSEQPKDSSLVGKHA 373

Query: 390 LSTLMPGMMPFFSSRETRG 334
           L  L+PG+  F   +  RG
Sbjct: 374 LVFLIPGVKKFSRKKLVRG 392


>04_01_0610 -
           7997406-7998047,7998379-7998426,8000719-8001143,
           8002301-8002589
          Length = 467

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 3/40 (7%)
 Frame = +1

Query: 370 PRHQGRQGCRPAVRIGRRMHHPGSGRPR---PALRPVQEG 480
           PRH  R  CRP     R  H P   RPR   P  RP + G
Sbjct: 402 PRHPPRPWCRPHTPRPRSPHSPTHPRPRLHHPLPRPTRTG 441


>01_01_0366 + 2871188-2871655
          Length = 155

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 3/57 (5%)
 Frame = -1

Query: 356 SPAGR-PEAFHRQPSGKGSRGT--GSHQRCSRRAQRQAE*ELAITTTVLLCVLHADV 195
           +PAG+ P+A  R P+GKG +G+  G   R  R+  +++     I    +L  +H D+
Sbjct: 27  APAGKKPKAEKRLPAGKGEKGSGEGKKDRAGRKKAKKSVETYKIYIFKVLKQVHPDI 83


>01_04_0072 - 15721866-15723563
          Length = 565

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 14/33 (42%), Positives = 18/33 (54%)
 Frame = -3

Query: 684 NLSGARFQGSCFAHQVKTSGFNNRHECVGSDRW 586
           NL+     GS  A+Q  +S FNN  EC  S+ W
Sbjct: 66  NLAQLLPTGSVMAYQALSSSFNNHGECYTSNWW 98


>01_04_0070 - 15704794-15706491
          Length = 565

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 14/33 (42%), Positives = 18/33 (54%)
 Frame = -3

Query: 684 NLSGARFQGSCFAHQVKTSGFNNRHECVGSDRW 586
           NL+     GS  A+Q  +S FNN  EC  S+ W
Sbjct: 66  NLAQLLPTGSVMAYQALSSSFNNHGECYTSNWW 98


>03_02_0367 +
           7834072-7834479,7834555-7834779,7834858-7835082,
           7835333-7836219,7836298-7836468,7836551-7836839,
           7836925-7836963,7837069-7837107
          Length = 760

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 27/105 (25%), Positives = 45/105 (42%), Gaps = 1/105 (0%)
 Frame = +2

Query: 167 HRYNGKAFAGHRRGEHR-GEPSSLSPTPIQPDAVLSENISGVILFHETLYQKADDGTPLV 343
           HR+    +AG +    R  E +  S TP+    +          +  T YQK DDGT ++
Sbjct: 143 HRFGTAEYAGKKEEWQREDEEAEESNTPLVFGDIPHPRARN---WARTRYQKKDDGTIIM 199

Query: 344 SLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQRCAQYKK 478
              E + +   IK  + V     S++ C+ +  DDL  +    K+
Sbjct: 200 PNPEDQRVYEAIK--ELVADQQASQEACSQRREDDLLMKALGNKE 242


>12_02_0167 -
           14824241-14824279,14824385-14824423,14824509-14824797,
           14824898-14824991,14825129-14825639,14825751-14826014,
           14826103-14826549,14826628-14826801,14827003-14827323
          Length = 725

 Score = 29.1 bits (62), Expect = 4.5
 Identities = 18/56 (32%), Positives = 28/56 (50%)
 Frame = +2

Query: 311 YQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQRCAQYKK 478
           YQK DDGT  +   E +G+   IK  + V     S++ C+ +  DDL  +    K+
Sbjct: 143 YQKNDDGTIFMPNAEDQGLYEAIK--ELVAEQQASQEACSQRREDDLPTKALGNKE 196


>08_01_0410 +
           3661304-3661383,3661494-3661673,3661757-3661870,
           3661975-3662133,3662193-3662243,3662838-3663018,
           3663102-3663228,3663322-3663431,3663529-3663667,
           3663767-3663876,3664002-3664071,3664247-3664320,
           3664458-3664553,3664682-3664777,3665041-3665168,
           3665422-3665656,3665743-3665910,3666274-3666381,
           3666468-3666617,3666905-3667015,3667118-3667297,
           3667427-3667555,3667819-3667914,3668108-3668293,
           3668431-3668603,3668720-3668921
          Length = 1150

 Score = 29.1 bits (62), Expect = 4.5
 Identities = 16/55 (29%), Positives = 26/55 (47%)
 Frame = +1

Query: 514 KIGRNTPSYQAIQENANVSRPLTLPSVRANAFVPIVEARSLYLMGEARTLEPRPR 678
           +I    P    +   +NVS P+ + S R +  +P V    L  M  +RT + +PR
Sbjct: 702 QINTKPPIVNTLGSVSNVSSPMAVNSERPDRALPTVSMSGLAPMDVSRTPDVKPR 756


>04_01_0347 -
           4546566-4546604,4546710-4546748,4546834-4547059,
           4547222-4547374,4547453-4547706,4547734-4548366,
           4548453-4548899,4548978-4549277,4549386-4549697,
           4550190-4550243
          Length = 818

 Score = 29.1 bits (62), Expect = 4.5
 Identities = 30/124 (24%), Positives = 51/124 (41%), Gaps = 1/124 (0%)
 Frame = +2

Query: 110 EDRSSNCSSRKGYPRR*RIHRYNGKAFAG-HRRGEHRGEPSSLSPTPIQPDAVLSENISG 286
           E R+S+ + R    +   +HR     +AG     +H  E +  S TP+    +       
Sbjct: 135 ESRASSEAYRLLQTKNQHLHRLGTAGYAGKEEEWQHEDEEAEESNTPLVFGDIPHPWARN 194

Query: 287 VILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQRCA 466
              +    YQK DDGT  +   E + +   IK  + V     S++ C+ +  DDL  +  
Sbjct: 195 ---WARARYQKKDDGTIFMPNPEDQRVYEAIK--ELVAEQQASQEVCSRRREDDLLTKAL 249

Query: 467 QYKK 478
             K+
Sbjct: 250 GNKE 253


>03_02_0119 - 5725588-5726688,5726793-5726894
          Length = 400

 Score = 29.1 bits (62), Expect = 4.5
 Identities = 13/32 (40%), Positives = 17/32 (53%)
 Frame = -1

Query: 512 SSNATWRSGSRPSCTGRSAGRGRPDPGWCIRL 417
           S   T  + ++P  TG   G GRP PG C+ L
Sbjct: 360 SLTTTTTTPAKPPLTGPRGGDGRPLPGGCLTL 391


>11_03_0006 + 8878611-8878724,8879323-8879706
          Length = 165

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 18/71 (25%), Positives = 24/71 (33%)
 Frame = +1

Query: 190 CRTSAWRTQRRTVVVIANSYSA*RCALREHLWCDPVPRDPLPEG*RWNASGLPAGEEGHH 369
           C   AW      + V+ +     R     H +    PR P P G   +    P+  EG  
Sbjct: 79  CSAVAWGGGTEELAVLVSGRGGVRARTPLHRYA--APRVPEPAGAAPHGDVFPSAGEGER 136

Query: 370 PRHQGRQGCRP 402
             H  R  C P
Sbjct: 137 AEHPPRPTCHP 147


>06_02_0114 +
           11991474-11991679,11997469-11998024,11998103-11998549,
           11998637-11999381,12002602-12002663
          Length = 671

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 30/124 (24%), Positives = 49/124 (39%), Gaps = 1/124 (0%)
 Frame = +2

Query: 110 EDRSSNCSSRKGYPRR*RIHRYNGKAFAG-HRRGEHRGEPSSLSPTPIQPDAVLSENISG 286
           E R+ + + R    R    HR     +AG     +   E +S S TP+    +       
Sbjct: 167 ESRARSEAYRLLQTRNQHPHRLGTAGYAGKEEEWQREDEEASQSCTPLVFGDIPHPRARN 226

Query: 287 VILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQRCA 466
              +    YQK DDGT  +   E + +   IK  K +     S++ C+ +  DDL  +  
Sbjct: 227 ---WARARYQKNDDGTIFMPNAEDQRVYEAIK--KLIAEQQASQEACSQRREDDLLTKAL 281

Query: 467 QYKK 478
             K+
Sbjct: 282 GNKE 285


>06_01_0965 -
           7430019-7430393,7430914-7431180,7431599-7431759,
           7431828-7432002,7432884-7432964
          Length = 352

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 16/62 (25%), Positives = 30/62 (48%)
 Frame = +1

Query: 613 PIVEARSLYLMGEARTLEPRPRKVNLKVVLGRPVLKRPLKRTTKFLPPRGKFLKAQNWLN 792
           P   AR++ L+ EAR L P P      +V  +P++++ ++     + PR   +      +
Sbjct: 5   PAAAARAV-LLREARHLRPGPAHYEKTLVATKPMIQKAIQELYSAVLPRTMLVADMGCSS 63

Query: 793 GP 798
           GP
Sbjct: 64  GP 65


>02_05_0466 + 29278009-29278575
          Length = 188

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 12/33 (36%), Positives = 15/33 (45%)
 Frame = +1

Query: 358 EGHHPRHQGRQGCRPAVRIGRRMHHPGSGRPRP 456
           +GH  +HQ  Q      + G   HHP  G P P
Sbjct: 129 KGHQQQHQQHQHQHHPQQHGMPQHHPQHGMPMP 161


>01_01_0516 + 3778891-3779069,3779436-3779541,3780526-3780888
          Length = 215

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 10/21 (47%), Positives = 16/21 (76%)
 Frame = -2

Query: 196 SCKRFPIVPVDSSAARIPFAG 134
           +C + P+VP+D++AA   FAG
Sbjct: 142 TCDKLPVVPLDAAAAHSIFAG 162


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,020,078
Number of Sequences: 37544
Number of extensions: 653757
Number of successful extensions: 2049
Number of sequences better than 10.0: 32
Number of HSP's better than 10.0 without gapping: 1915
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2047
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2268190812
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).