SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30055
         (803 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_06_1289 - 36010924-36011001,36011441-36011518,36012321-360124...    54   1e-07
05_05_0110 + 22470869-22470920,22471044-22471146,22473261-224733...    54   2e-07
06_01_0650 - 4701939-4702224,4702513-4702604,4703022-4703049,470...    42   8e-04
03_02_0755 + 10932897-10933010,10933446-10933577,10933666-109337...    36   0.029
01_06_1150 + 34910941-34911010,34911611-34911738,34912025-349121...    36   0.029
01_06_0129 - 26770543-26770720,26774592-26774719,26774829-267749...    34   0.12 
06_03_0198 - 17797574-17797717,17797995-17798099,17798509-177986...    34   0.15 
02_01_0154 + 1078561-1078630,1078758-1078885,1079016-1079120,107...    34   0.15 
04_04_1516 - 34122205-34122348,34122430-34122534,34122878-341230...    33   0.35 
03_06_0260 - 32717142-32717270,32717743-32717831,32717950-327180...    33   0.35 
09_02_0285 + 6894899-6895114,6896197-6896422,6896889-6896992,689...    32   0.46 
07_01_0481 - 3621798-3621926,3622572-3622660,3622780-3622933,362...    32   0.46 
06_03_1005 + 26837047-26837093,26837644-26837731,26837854-268379...    32   0.61 
02_02_0339 + 9115297-9115366,9116280-9116407,9117537-9117641,911...    31   0.81 
10_08_0755 - 20329127-20329189,20329276-20329389,20329465-203296...    31   1.4  
03_01_0159 + 1298002-1298070,1298181-1298264,1300354-1300506,130...    31   1.4  
05_07_0076 - 27520152-27520379,27520785-27521096,27521194-275213...    30   1.9  
03_05_0699 - 26914930-26915052,26915636-26915738,26916044-269161...    30   1.9  
07_01_0069 + 505291-505327,505726-505956,506317-506652,507025-50...    29   3.3  
02_05_0556 - 29940146-29940158,29941060-29941240,29941271-29941670     29   4.3  
01_01_0939 - 7404209-7404490,7405057-7405368,7405470-7405609,740...    29   5.7  
01_01_0928 + 7339796-7339806,7339923-7340043,7340463-7340549,734...    29   5.7  
12_02_1249 - 27331801-27331896,27331984-27332072,27334020-273340...    28   7.6  
12_02_0973 + 24959440-24959451,24959962-24962195,24962539-249626...    28   7.6  
01_01_1187 + 9444742-9445317                                           28   7.6  
03_05_0006 + 19527479-19528769,19529693-19530105,19530220-195304...    28   10.0 
03_01_0296 + 2284385-2285629,2287632-2288594                           28   10.0 

>01_06_1289 -
           36010924-36011001,36011441-36011518,36012321-36012421,
           36012506-36012603,36016213-36016315,36016435-36016486
          Length = 169

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 25/54 (46%), Positives = 35/54 (64%)
 Frame = +2

Query: 344 MSNTVPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLY 505
           M+ T+  +S L  L  + K L + PV+GF   L+ + N+FEW+V I GPPDTLY
Sbjct: 1   MAATISQASLL--LQKQLKDLAKHPVDGFSAGLVDDSNVFEWQVTIIGPPDTLY 52



 Score = 37.9 bits (84), Expect = 0.009
 Identities = 14/18 (77%), Positives = 16/18 (88%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPNVY +G +CISILHPP
Sbjct: 82  HPNVYPDGRVCISILHPP 99



 Score = 36.3 bits (80), Expect = 0.029
 Identities = 20/55 (36%), Positives = 26/55 (47%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIRVFN*SLGIQMYMKTEIFAYRFSTRPWDDPQSGEL 675
           GYF A M FP +YP SPP++R  +      +Y    +        P DDP   EL
Sbjct: 55  GYFNAIMSFPQNYPNSPPTVRFTSEMWHPNVYPDGRV-CISILHPPGDDPNGYEL 108


>05_05_0110 +
           22470869-22470920,22471044-22471146,22473261-22473358,
           22473430-22473530,22474052-22474129,22474578-22474655
          Length = 169

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 23/47 (48%), Positives = 30/47 (63%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLY 505
           S A   L  + K L + PV+GF   L+ + N+FEW+V I GPPDTLY
Sbjct: 6   SQASLLLQKQLKDLAKNPVDGFSAGLVDDSNVFEWQVTIIGPPDTLY 52



 Score = 37.9 bits (84), Expect = 0.009
 Identities = 14/18 (77%), Positives = 16/18 (88%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPNVY +G +CISILHPP
Sbjct: 82  HPNVYPDGRVCISILHPP 99



 Score = 35.9 bits (79), Expect = 0.038
 Identities = 14/21 (66%), Positives = 16/21 (76%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIR 573
           GYF A M FP +YP SPPS+R
Sbjct: 55  GYFNAIMTFPQNYPNSPPSVR 75


>06_01_0650 -
           4701939-4702224,4702513-4702604,4703022-4703049,
           4703440-4703479,4703611-4703672,4703864-4703927,
           4704043-4704081,4705571-4705625,4705730-4705786
          Length = 240

 Score = 41.5 bits (93), Expect = 8e-04
 Identities = 15/28 (53%), Positives = 19/28 (67%)
 Frame = +1

Query: 487 TAGYTLSSGYFKAHMKFPPDYPYSPPSI 570
           +AG     GY+   +KFPPDYP+ PPSI
Sbjct: 44  SAGTPFEGGYYYGKLKFPPDYPFKPPSI 71


>03_02_0755 +
           10932897-10933010,10933446-10933577,10933666-10933750,
           10934668-10934831,10934911-10935357
          Length = 313

 Score = 36.3 bits (80), Expect = 0.029
 Identities = 17/46 (36%), Positives = 26/46 (56%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           A++ +  E K +Q  P   F    L ED +FEW+ AI GP D+ ++
Sbjct: 13  AVKRILQEVKEMQSNPSPDFMAMPLEED-IFEWQFAILGPRDSEFE 57


>01_06_1150 +
           34910941-34911010,34911611-34911738,34912025-34912129,
           34912525-34912668
          Length = 148

 Score = 36.3 bits (80), Expect = 0.029
 Identities = 17/45 (37%), Positives = 24/45 (53%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLY 505
           A + +  E K LQ++P         GED +F W+  I GPPD+ Y
Sbjct: 2   ASKRILKELKDLQKDPPTSCSAGPAGED-MFHWQATIMGPPDSPY 45



 Score = 32.7 bits (71), Expect = 0.35
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           + G F  ++ FPPDYP+ PP +
Sbjct: 46  AGGVFLVNIHFPPDYPFKPPKV 67


>01_06_0129 -
           26770543-26770720,26774592-26774719,26774829-26774933,
           26775661-26775788,26777332-26777433,26778760-26778861,
           26779777-26779852,26779971-26780059,26780177-26780230,
           26780482-26780614,26780671-26780797,26781590-26781648
          Length = 426

 Score = 34.3 bits (75), Expect = 0.12
 Identities = 22/74 (29%), Positives = 33/74 (44%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           A + +  E K LQ++P        +GED +F W+  I GP D+ Y       T + P   
Sbjct: 226 ASKRIQKELKDLQKDPPTSCSAGPVGED-MFHWQATIMGPSDSPYAGGVFLVTIHFPPDY 284

Query: 551 RIHHHPLGFLTKVW 592
                 + F TKV+
Sbjct: 285 PFKPPKVAFRTKVF 298



 Score = 31.5 bits (68), Expect = 0.81
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           + G F   + FPPDYP+ PP +
Sbjct: 270 AGGVFLVTIHFPPDYPFKPPKV 291



 Score = 27.9 bits (59), Expect = 10.0
 Identities = 15/38 (39%), Positives = 18/38 (47%)
 Frame = +3

Query: 525 THEIPP*LPVFTTIH*GF*LKSGHPNVYENGDLCISIL 638
           T   PP  P F      F  K  HPN+  NG +C+ IL
Sbjct: 277 TIHFPPDYP-FKPPKVAFRTKVFHPNINSNGSICLDIL 313


>06_03_0198 -
           17797574-17797717,17797995-17798099,17798509-17798636,
           17799444-17799513
          Length = 148

 Score = 33.9 bits (74), Expect = 0.15
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLY 505
           A + +  E K LQ++P        +GED +F W+  I GP D+ Y
Sbjct: 2   ASKRILKELKDLQKDPPTSCSAGPVGED-MFHWQATIMGPADSPY 45



 Score = 31.9 bits (69), Expect = 0.61
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           + G F   + FPPDYP+ PP +
Sbjct: 46  AGGVFLVSIHFPPDYPFKPPKV 67


>02_01_0154 +
           1078561-1078630,1078758-1078885,1079016-1079120,
           1079228-1079371
          Length = 148

 Score = 33.9 bits (74), Expect = 0.15
 Identities = 22/74 (29%), Positives = 32/74 (43%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           ALR +  E K LQ +P        + +D +F W+  I GP D+ Y       T + P   
Sbjct: 2   ALRRIIKELKDLQRDPPTSCSAGPVSDD-MFHWQATIMGPNDSPYSGGVFLVTIHFPPDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F TKV+
Sbjct: 61  PFKPPKVAFKTKVF 74



 Score = 32.7 bits (71), Expect = 0.35
 Identities = 11/22 (50%), Positives = 14/22 (63%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           S G F   + FPPDYP+ PP +
Sbjct: 46  SGGVFLVTIHFPPDYPFKPPKV 67



 Score = 28.3 bits (60), Expect = 7.6
 Identities = 15/38 (39%), Positives = 19/38 (50%)
 Frame = +3

Query: 525 THEIPP*LPVFTTIH*GF*LKSGHPNVYENGDLCISIL 638
           T   PP  P F      F  K  HPN+  NG++C+ IL
Sbjct: 53  TIHFPPDYP-FKPPKVAFKTKVFHPNINSNGNICLDIL 89


>04_04_1516 -
           34122205-34122348,34122430-34122534,34122878-34123005,
           34124003-34124072
          Length = 148

 Score = 32.7 bits (71), Expect = 0.35
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           + G F  ++ FPPDYP+ PP +
Sbjct: 46  AGGVFLVNIHFPPDYPFKPPKV 67



 Score = 32.3 bits (70), Expect = 0.46
 Identities = 15/43 (34%), Positives = 23/43 (53%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDT 499
           A + +  E K LQ++P        +GED +F W+  I GP D+
Sbjct: 2   ASKRILKELKDLQKDPPTSCSAGPVGED-MFHWQATIMGPSDS 43


>03_06_0260 -
           32717142-32717270,32717743-32717831,32717950-32718039,
           32721571-32721596,32721772-32721896
          Length = 152

 Score = 32.7 bits (71), Expect = 0.35
 Identities = 17/56 (30%), Positives = 29/56 (51%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT 529
           ++ A + L  ++K LQ++P  G       ++N+  W   IFGP DT +   T + T
Sbjct: 2   STPARKRLMRDFKRLQQDPPAGIS-GAPHDNNIMLWNAVIFGPDDTPWDGGTFKLT 56



 Score = 27.9 bits (59), Expect = 10.0
 Identities = 16/44 (36%), Positives = 22/44 (50%)
 Frame = +3

Query: 507 KWILQGTHEIPP*LPVFTTIH*GF*LKSGHPNVYENGDLCISIL 638
           K  LQ T + P   PV   +   F     HPN+Y +G +C+ IL
Sbjct: 54  KLTLQFTEDYPNKPPVVRFVSRMF-----HPNIYADGSICLDIL 92


>09_02_0285 +
           6894899-6895114,6896197-6896422,6896889-6896992,
           6897121-6897239,6897445-6897634
          Length = 284

 Score = 32.3 bits (70), Expect = 0.46
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           + G F  ++ FPPDYP+ PP +
Sbjct: 46  AGGVFFVNIHFPPDYPFKPPKV 67



 Score = 29.9 bits (64), Expect = 2.5
 Identities = 15/45 (33%), Positives = 22/45 (48%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLY 505
           A + +  E   L+++P         GED LF W+  I GP D+ Y
Sbjct: 2   ASKRIQKELMDLRKDPPTSCSAGPAGED-LFHWQATIMGPSDSPY 45


>07_01_0481 -
           3621798-3621926,3622572-3622660,3622780-3622933,
           3624104-3624111,3625522-3625547,3625757-3625881
          Length = 176

 Score = 32.3 bits (70), Expect = 0.46
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 3/36 (8%)
 Frame = +1

Query: 475 GNLR---TAGYTLSSGYFKAHMKFPPDYPYSPPSIR 573
           GNLR   T    +S G FK  ++F  DYP  PP++R
Sbjct: 60  GNLRSRLTVNSYVSVGTFKLTLQFTEDYPNKPPTVR 95



 Score = 31.9 bits (69), Expect = 0.61
 Identities = 15/46 (32%), Positives = 25/46 (54%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDT 499
           ++ A + L  ++K LQ++P  G       ++N+  W   IFGP DT
Sbjct: 2   STPARKRLMRDFKRLQQDPPAGIS-GAPHDNNIMLWNAVIFGPDDT 46


>06_03_1005 +
           26837047-26837093,26837644-26837731,26837854-26837998,
           26838150-26838227,26838323-26838435,26838538-26838641,
           26838804-26839119
          Length = 296

 Score = 31.9 bits (69), Expect = 0.61
 Identities = 18/47 (38%), Positives = 26/47 (55%)
 Frame = +2

Query: 368 SALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           + +R LA E KSL E P EG +V ++ +D+       I GP  T Y+
Sbjct: 54  NVVRQLAKELKSLDESPPEGIKV-IVNDDDFTTIFADIEGPAGTPYE 99


>02_02_0339 +
           9115297-9115366,9116280-9116407,9117537-9117641,
           9118165-9118259,9119472-9119538,9119685-9119720
          Length = 166

 Score = 31.5 bits (68), Expect = 0.81
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           + G F   + FPPDYP+ PP +
Sbjct: 46  AGGVFLVTIHFPPDYPFKPPKV 67



 Score = 30.7 bits (66), Expect = 1.4
 Identities = 14/45 (31%), Positives = 23/45 (51%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLY 505
           A + +  E K LQ++P        + ED +F W+  + GP D+ Y
Sbjct: 2   ASKRILKELKDLQKDPPTSCSAGPVAED-MFHWQATLMGPSDSPY 45


>10_08_0755 -
           20329127-20329189,20329276-20329389,20329465-20329617,
           20331790-20332035
          Length = 191

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 14/28 (50%), Positives = 18/28 (64%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG*SSVWRTA 677
           HPNVY +G +C+SIL+   G    WR A
Sbjct: 115 HPNVYPSGTVCLSILNEDSG----WRPA 138


>03_01_0159 +
           1298002-1298070,1298181-1298264,1300354-1300506,
           1300589-1300702,1300814-1300876
          Length = 160

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 14/28 (50%), Positives = 18/28 (64%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG*SSVWRTA 677
           HPNVY +G +C+SIL+   G    WR A
Sbjct: 84  HPNVYPSGTVCLSILNEDSG----WRPA 107


>05_07_0076 -
           27520152-27520379,27520785-27521096,27521194-27521333,
           27521893-27521956,27522071-27522277,27522350-27522493,
           27522578-27522709,27522880-27524294,27524647-27524920,
           27526096-27526129,27527028-27527059
          Length = 993

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +1

Query: 490 AGYTLSSGYFKAHMKFPPDYPYSPPSI 570
           AG       F   + FPPDYP+ PPS+
Sbjct: 790 AGTPYHDNLFFFDIFFPPDYPHEPPSV 816



 Score = 27.9 bits (59), Expect = 10.0
 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 1/26 (3%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG-*SSVW 668
           +PN+YE+G +C+S+L    G  S VW
Sbjct: 826 NPNLYESGKVCLSLLKTWAGTGSEVW 851


>03_05_0699 -
           26914930-26915052,26915636-26915738,26916044-26916147,
           26916298-26916327
          Length = 119

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 19/57 (33%), Positives = 25/57 (43%)
 Frame = +2

Query: 347 SNTVPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDT 517
           S  V +  A   L  E    Q  P  GF+ K+   DNL  W + + G   TLY  +T
Sbjct: 8   SRKVLSKIACNRLQKELAEWQVNPPSGFKHKVT--DNLQRWVIEVAGAAGTLYAGET 62


>07_01_0069 +
           505291-505327,505726-505956,506317-506652,507025-507372,
           507735-508594,508902-508971,509157-509371,509477-509537,
           509606-509715,510644-510694,510794-510916
          Length = 813

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 16/46 (34%), Positives = 20/46 (43%)
 Frame = +2

Query: 449 EDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTTRIHHHPLGFLTK 586
           ED    WE   F P +TL   D+      +P  T I  HP  +L K
Sbjct: 669 EDPDLPWEQEEFSPSNTLLVDDSPYKALGNPPHTAIFPHPYSYLNK 714


>02_05_0556 - 29940146-29940158,29941060-29941240,29941271-29941670
          Length = 197

 Score = 29.1 bits (62), Expect = 4.3
 Identities = 17/49 (34%), Positives = 23/49 (46%)
 Frame = +2

Query: 359 PTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLY 505
           P  +A R ++ E + L  +P    R       +L  WEV I GPP T Y
Sbjct: 32  PRKAAQRRISRELEDLWLDPPAYCRPGPEPVTDLLHWEVIIDGPPGTPY 80


>01_01_0939 -
           7404209-7404490,7405057-7405368,7405470-7405609,
           7406226-7406289,7406378-7406616,7406957-7406983,
           7407590-7407749
          Length = 407

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = +1

Query: 490 AGYTLSSGYFKAHMKFPPDYPYSPPSI 570
           AG     G F   ++FP +YP SPP +
Sbjct: 186 AGTPYHDGLFFFDVRFPSEYPQSPPKV 212


>01_01_0928 +
           7339796-7339806,7339923-7340043,7340463-7340549,
           7341230-7341637,7341726-7341789,7342654-7342793,
           7342878-7343189,7343733-7344137
          Length = 515

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 18/65 (27%), Positives = 28/65 (43%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG*SSVWRTAPANVGNPTQSVRNRYSPSGNLNPSKEPEHLSV 773
           +PN+Y NG +C+S+L         W  +     NP+QS   +   S       E  + + 
Sbjct: 289 NPNLYNNGKVCLSLL-------GTWAGSGCETWNPSQSTMLQVLVSIQALILNEKPYFNE 341

Query: 774 PGERS 788
           PG  S
Sbjct: 342 PGYAS 346


>12_02_1249 -
           27331801-27331896,27331984-27332072,27334020-27334083,
           27334208-27334336,27334554-27334607,27334712-27334741
          Length = 153

 Score = 28.3 bits (60), Expect = 7.6
 Identities = 8/16 (50%), Positives = 13/16 (81%)
 Frame = +3

Query: 594 HPNVYENGDLCISILH 641
           HP++Y NG +C+ IL+
Sbjct: 81  HPHIYSNGHICLDILY 96


>12_02_0973 + 24959440-24959451,24959962-24962195,24962539-24962653,
            24963146-24963943,24964140-24964422,24964500-24964951,
            24965744-24965870,24965950-24966074,24966188-24966858,
            24966976-24967093,24967177-24967293,24967564-24967658,
            24968152-24968303,24968858-24968913,24969001-24969218,
            24969842-24970239,24970345-24970628,24970730-24970836,
            24970882-24970968,24971729-24971990,24972228-24972503,
            24973197-24973254,24973437-24973756,24973889-24973999,
            24974183-24974350,24974494-24974622,24974731-24974820,
            24974934-24975040,24975133-24975281,24975584-24975666,
            24975749-24975844,24975957-24976079,24976180-24976263,
            24976371-24976511,24976652-24976951,24977386-24977453,
            24977540-24977642,24979363-24979524,24979613-24981230,
            24981270-24981661,24981689-24981991,24982078-24982161,
            24982296-24982448,24982678-24982841,24982915-24983062,
            24983209-24983331,24983409-24983496,24983686-24983867
          Length = 4177

 Score = 28.3 bits (60), Expect = 7.6
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +1

Query: 25   SSDYVSLNGASLSHCCLTDRVLWVYCFVYFS 117
            SS  V LNG  L+H  +T R L++ C  ++S
Sbjct: 2626 SSSAVELNGVLLNHALVTFRELFLKCAQHYS 2656


>01_01_1187 + 9444742-9445317
          Length = 191

 Score = 28.3 bits (60), Expect = 7.6
 Identities = 8/19 (42%), Positives = 13/19 (68%)
 Frame = +1

Query: 517 FKAHMKFPPDYPYSPPSIR 573
           ++  + FP +YPY PP +R
Sbjct: 96  YRLSLAFPGEYPYKPPKVR 114


>03_05_0006 +
           19527479-19528769,19529693-19530105,19530220-19530430,
           19530531-19530768,19530847-19530997,19531240-19531542
          Length = 868

 Score = 27.9 bits (59), Expect = 10.0
 Identities = 18/54 (33%), Positives = 23/54 (42%), Gaps = 1/54 (1%)
 Frame = -2

Query: 796 VGIDRSPGTERCSGSFEGLRLPE-GEYRLRTDCVGFPTFAGAVRQTEDHPTGGW 638
           +GID   G +R   S+     P  GEY  R D  G P F      T  + +G W
Sbjct: 165 LGIDFRTGLDRYMNSWRAADDPSPGEYSFRIDPSGSPEFFLYRWSTRTYGSGPW 218


>03_01_0296 + 2284385-2285629,2287632-2288594
          Length = 735

 Score = 27.9 bits (59), Expect = 10.0
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +1

Query: 67  CCLTDRVLWVYC 102
           CCL DR+LW+ C
Sbjct: 430 CCLLDRILWLVC 441


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,639,862
Number of Sequences: 37544
Number of extensions: 576319
Number of successful extensions: 1442
Number of sequences better than 10.0: 27
Number of HSP's better than 10.0 without gapping: 1353
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1442
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2185924824
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).