SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30049
         (727 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_03_1284 - 28988287-28988922,28989335-28989765,28989850-289899...    98   7e-21
02_01_0355 + 2558792-2558862,2558993-2559099,2559185-2559615,256...    96   3e-20
03_05_0052 - 20293197-20293310,20293938-20294024,20294133-202942...    94   1e-19
01_06_0020 + 25630728-25631023,25631308-25631548,25631629-256317...    93   3e-19
02_02_0099 + 6768115-6768285,6769950-6770034,6770501-6770628,677...    65   5e-11
10_08_0553 - 18720436-18720494,18721102-18721106,18721136-187212...    58   5e-09
04_04_0613 + 26617677-26617963,26618726-26618786,26619598-266198...    58   5e-09
02_05_0096 + 25785995-25786311,25786716-25786776,25787825-257880...    58   5e-09
06_03_1255 + 28780181-28781172,28782065-28782932                       48   8e-06
03_05_0997 + 29565311-29565664,29566134-29566298,29566572-295666...    48   8e-06
07_03_1392 - 26238885-26239007,26239137-26239235,26239636-262397...    48   1e-05
07_03_1566 + 27766336-27766393,27766480-27766609,27766728-277667...    46   2e-05
03_02_0758 + 10954268-10954841,10955988-10957145,10957176-109572...    45   7e-05
03_01_0059 + 484305-484617,484919-485406,485608-486092,486185-48...    45   7e-05
08_02_0671 - 19890187-19890295,19891186-19891320,19891551-198919...    44   9e-05
12_02_0340 - 17725866-17725884,17726046-17726326,17726842-177269...    44   2e-04
08_01_0397 - 3509186-3510291,3510322-3512335                           44   2e-04
11_06_0767 + 27121761-27123335,27123701-27123910,27124843-271249...    43   3e-04
08_01_0353 - 3107628-3107774,3108177-3108213,3108248-3109164,310...    43   3e-04
03_05_0619 - 26180980-26181105,26181329-26181417,26181518-261816...    42   4e-04
03_01_0399 + 3097878-3098141,3098254-3098547,3098659-3098886,309...    42   4e-04
02_01_0381 - 2764331-2764342,2768966-2769907                           42   5e-04
06_03_0674 + 23422004-23422552,23423295-23423369,23424360-234244...    42   7e-04
03_06_0365 - 33399422-33399925,33400470-33400583,33400762-334009...    42   7e-04
01_01_0682 - 5244805-5244919,5246468-5246613,5246813-5246994,524...    41   9e-04
03_05_0865 - 28365430-28367640                                         41   0.001
01_05_0721 + 24594815-24594834,24595207-24595313,24595417-245954...    41   0.001
01_06_1758 - 39681942-39682030,39682115-39682345,39682643-396826...    40   0.002
01_01_0602 - 4484972-4485450,4485949-4485997,4486108-4486237,448...    40   0.002
01_01_0509 - 3713109-3713244,3713689-3713733,3713959-3714015,371...    40   0.002
07_01_0725 - 5532803-5533324,5533631-5533657,5534285-5534398,553...    40   0.002
01_05_0722 + 24598426-24598649,24599113-24599219,24599319-245993...    40   0.002
07_03_0601 - 19872780-19873099,19873148-19873151,19874196-198743...    39   0.005
02_05_1293 - 35520733-35520963,35521696-35521878,35522040-355222...    39   0.005
12_02_1076 - 25862671-25863159,25863290-25863451,25863614-258638...    38   0.006
01_05_0296 + 20567259-20567386,20568895-20569123,20569205-205694...    38   0.008
01_05_0295 + 20537147-20537291,20539111-20539283,20539365-205395...    38   0.008
01_05_0292 + 20518668-20519090,20519213-20519281,20520204-205204...    38   0.011
11_06_0300 + 22095396-22096145,22096261-22096344,22097062-220973...    37   0.014
01_07_0333 - 42813789-42814073,42814229-42814315,42815083-428151...    37   0.014
07_03_1500 + 27001842-27002058,27002144-27002283,27002458-270025...    36   0.025
04_04_0476 - 25508952-25509004,25509245-25509326,25509453-255096...    36   0.033
02_01_0765 - 5694535-5694644,5695039-5696550,5697229-5697390,569...    36   0.043
05_01_0079 + 531617-531734,531987-532059,532152-532261,532400-53...    35   0.057
07_01_0322 - 2258067-2258519,2258620-2258781,2258896-2259159,225...    35   0.076
03_06_0344 - 33276366-33276548,33277044-33277169,33277254-332773...    35   0.076
09_03_0167 + 12965030-12965356,12966100-12966387,12966704-129668...    33   0.17 
07_02_0023 - 11918735-11918827,11919139-11919231,11919320-119194...    33   0.23 
03_06_0531 + 34552206-34552598,34552665-34552735,34553363-345533...    32   0.40 
02_05_0498 - 29520062-29520758,29521552-29521860,29523525-29524735     32   0.53 
07_03_0114 + 13571305-13571553                                         30   1.6  
02_05_1118 + 34241819-34242217,34242350-34242522,34243499-342436...    30   1.6  
01_01_0447 - 3327727-3328144,3328438-3328688,3328820-3328909,332...    30   2.2  
02_01_0505 + 3676117-3676890                                           29   3.8  
01_04_0048 - 15421003-15422355                                         29   3.8  
09_02_0088 + 4136698-4136857,4137530-4137558,4137992-4138954,413...    29   5.0  
06_03_0337 + 19678152-19678484,19678616-19678801,19679232-196794...    29   5.0  
02_02_0619 - 12205718-12205845,12205941-12206142,12207240-122073...    29   5.0  
04_04_1377 - 33064906-33065607                                         28   6.6  
10_06_0143 - 11183574-11183761,11183989-11184344,11184437-111845...    28   8.7  

>06_03_1284 -
           28988287-28988922,28989335-28989765,28989850-28989956,
           28990066-28990136
          Length = 414

 Score = 97.9 bits (233), Expect = 7e-21
 Identities = 46/66 (69%), Positives = 55/66 (83%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATF   ILQQ+D ++ ECQAL+LAPTRELAQQI+KV+ ALGD+L  K HAC+GGT+VR
Sbjct: 91  KTATFCSGILQQLDYAVVECQALVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVR 150

Query: 434 EDIRQL 451
           ED R L
Sbjct: 151 EDQRIL 156



 Score = 92.3 bits (219), Expect = 4e-19
 Identities = 43/58 (74%), Positives = 49/58 (84%)
 Frame = +3

Query: 84  TDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           T +D+V E+FDDM L+E LLRGIYAYGFEKPSAIQQR I+P  +G DVI QAQSGTGK
Sbjct: 34  TSYDEVHESFDDMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGK 91



 Score = 32.7 bits (71), Expect = 0.31
 Identities = 15/27 (55%), Positives = 19/27 (70%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DM+       + IK+FVLDEADE
Sbjct: 168 GRVFDMLRRQSLRPDYIKMFVLDEADE 194


>02_01_0355 +
           2558792-2558862,2558993-2559099,2559185-2559615,
           2560100-2560735
          Length = 414

 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 45/66 (68%), Positives = 54/66 (81%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATF   ILQQ+D  + ECQ+L+LAPTRELAQQI+KV+ ALGD+L  K HAC+GGT+VR
Sbjct: 91  KTATFCSGILQQLDYGLVECQSLVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVR 150

Query: 434 EDIRQL 451
           ED R L
Sbjct: 151 EDQRIL 156



 Score = 93.1 bits (221), Expect = 2e-19
 Identities = 43/58 (74%), Positives = 49/58 (84%)
 Frame = +3

Query: 84  TDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           T +D+V E+FDDM L+E LLRGIYAYGFEKPSAIQQR I+P  +G DVI QAQSGTGK
Sbjct: 34  TSYDEVFESFDDMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGK 91



 Score = 32.7 bits (71), Expect = 0.31
 Identities = 15/27 (55%), Positives = 19/27 (70%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DM+       + IK+FVLDEADE
Sbjct: 168 GRVFDMLRRQSLRPDHIKMFVLDEADE 194


>03_05_0052 -
           20293197-20293310,20293938-20294024,20294133-20294270,
           20295009-20295128,20295236-20295343,20296053-20296133,
           20296216-20296456,20297010-20297305
          Length = 394

 Score = 93.9 bits (223), Expect = 1e-19
 Identities = 41/54 (75%), Positives = 49/54 (90%)
 Frame = +3

Query: 96  QVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +V+ +FD M ++E+LLRGIYAYGFEKPSAIQQRA++P I GRDVIAQAQSGTGK
Sbjct: 28  EVISSFDQMGIREDLLRGIYAYGFEKPSAIQQRAVLPIISGRDVIAQAQSGTGK 81



 Score = 89.4 bits (212), Expect = 3e-18
 Identities = 38/67 (56%), Positives = 56/67 (83%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KT+  S+S+ Q +DT++RE QALIL+PTRELA Q ++V++A+GD++N + HACIGG ++ 
Sbjct: 81  KTSMISLSVCQIVDTAVREVQALILSPTRELAAQTERVMLAIGDYINIQVHACIGGKSIG 140

Query: 434 EDIRQLE 454
           EDIR+LE
Sbjct: 141 EDIRKLE 147



 Score = 29.9 bits (64), Expect = 2.2
 Identities = 15/27 (55%), Positives = 16/27 (59%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV DMI         IKL +LDEADE
Sbjct: 158 GRVCDMIKRRTLRTRAIKLLILDEADE 184


>01_06_0020 +
           25630728-25631023,25631308-25631548,25631629-25631709,
           25632109-25632216,25632329-25632448,25632806-25632943,
           25633064-25633150,25633802-25633915
          Length = 394

 Score = 92.7 bits (220), Expect = 3e-19
 Identities = 40/54 (74%), Positives = 49/54 (90%)
 Frame = +3

Query: 96  QVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +V+ +FD M ++++LLRGIYAYGFEKPSAIQQRA++P I GRDVIAQAQSGTGK
Sbjct: 28  EVISSFDQMGIRDDLLRGIYAYGFEKPSAIQQRAVLPIISGRDVIAQAQSGTGK 81



 Score = 88.2 bits (209), Expect = 6e-18
 Identities = 38/67 (56%), Positives = 55/67 (82%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KT+  S+S+ Q +DT++RE QALIL+PTRELA Q ++V++A+GD +N + HACIGG ++ 
Sbjct: 81  KTSMISLSVCQIVDTAVREVQALILSPTRELAAQTERVMLAIGDFINIQVHACIGGKSIG 140

Query: 434 EDIRQLE 454
           EDIR+LE
Sbjct: 141 EDIRKLE 147



 Score = 29.9 bits (64), Expect = 2.2
 Identities = 15/27 (55%), Positives = 16/27 (59%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV DMI         IKL +LDEADE
Sbjct: 158 GRVCDMIKRRTLRTRAIKLLILDEADE 184


>02_02_0099 +
           6768115-6768285,6769950-6770034,6770501-6770628,
           6771429-6771465,6773108-6774193,6774337-6774447,
           6774701-6774817,6774818-6775120,6776092-6776513,
           6776645-6777274
          Length = 1029

 Score = 65.3 bits (152), Expect = 5e-11
 Identities = 30/61 (49%), Positives = 39/61 (63%)
 Frame = +2

Query: 257 TATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVRE 436
           T T    ILQ++D +  ECQAL+L PT +LA + Q V+  LG  L+AK HA  GGT+  E
Sbjct: 710 TVTLCCGILQRLDYASTECQALVLVPTHDLAHETQNVIGVLGQFLSAKAHAFCGGTSAHE 769

Query: 437 D 439
           D
Sbjct: 770 D 770



 Score = 36.3 bits (80), Expect = 0.025
 Identities = 18/51 (35%), Positives = 26/51 (50%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           +V T     + E L+        +KPSA+ QR I+P   G D+I Q+  GT
Sbjct: 659 IVTTQGAQFISESLIGETQTKDLDKPSAVHQRGIVPLCNGLDIIQQSLFGT 709


>10_08_0553 -
           18720436-18720494,18721102-18721106,18721136-18721257,
           18721390-18721478,18722136-18722316,18722403-18722654,
           18722755-18722993,18723680-18723914,18724072-18724132,
           18724632-18724987
          Length = 532

 Score = 58.4 bits (135), Expect = 5e-09
 Identities = 26/49 (53%), Positives = 36/49 (73%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+D  LK ELL GIY  GFE+PS IQ+ +I   + G D++A+A++GTGK
Sbjct: 149 FEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGK 197



 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 29/66 (43%), Positives = 40/66 (60%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F I  L++ID      Q +IL PTRELA Q  +V   LG +LN +     GGT+++
Sbjct: 197 KTAAFCIPALEKIDPEKNAIQVVILVPTRELALQTSQVCKELGKYLNIQVMVSTGGTSLK 256

Query: 434 EDIRQL 451
           +DI +L
Sbjct: 257 DDIMRL 262


>04_04_0613 +
           26617677-26617963,26618726-26618786,26619598-26619832,
           26619958-26620196,26620493-26620744,26620844-26621024,
           26621810-26621898,26622200-26622273,26622365-26622443
          Length = 498

 Score = 58.4 bits (135), Expect = 5e-09
 Identities = 26/49 (53%), Positives = 36/49 (73%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+D  LK ELL GIY  GFE+PS IQ+ +I   + G D++A+A++GTGK
Sbjct: 126 FEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGK 174



 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 29/66 (43%), Positives = 39/66 (59%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F I  L++ID      Q +IL PTRELA Q  +V   LG HL  +     GGT+++
Sbjct: 174 KTAAFCIPALEKIDQDKNAIQVVILVPTRELALQTSQVCKELGKHLKIQVMVTTGGTSLK 233

Query: 434 EDIRQL 451
           +DI +L
Sbjct: 234 DDIVRL 239


>02_05_0096 +
           25785995-25786311,25786716-25786776,25787825-25788059,
           25788292-25788530,25789700-25789951,25790043-25790223,
           25790864-25790952,25791269-25791342,25791481-25791584,
           25791919-25791957,25792324-25792436
          Length = 567

 Score = 58.4 bits (135), Expect = 5e-09
 Identities = 26/49 (53%), Positives = 36/49 (73%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+D  LK ELL GIY  GFE+PS IQ+ +I   + G D++A+A++GTGK
Sbjct: 136 FEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGK 184



 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 29/66 (43%), Positives = 39/66 (59%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F I  L++ID      Q +IL PTRELA Q  +V   LG HL  +     GGT+++
Sbjct: 184 KTAAFCIPALEKIDQEKNAIQVVILVPTRELALQTSQVCKELGKHLKIQVMVTTGGTSLK 243

Query: 434 EDIRQL 451
           +DI +L
Sbjct: 244 DDIIRL 249


>06_03_1255 + 28780181-28781172,28782065-28782932
          Length = 619

 Score = 48.0 bits (109), Expect = 8e-06
 Identities = 27/73 (36%), Positives = 40/73 (54%), Gaps = 3/73 (4%)
 Frame = +3

Query: 57  REWTLGHLHTDWDQVV---ETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDV 227
           R W   H+  D D V     +F D+ L E +LR +   G EKP+ IQ + +   + GRD+
Sbjct: 157 RSW---HILVDGDDVPPPSRSFGDLRLPEPILRALRGKGIEKPTPIQVQGLPVALSGRDM 213

Query: 228 IAQAQSGTGKLLL 266
           I  A +G+GK L+
Sbjct: 214 IGIAFTGSGKTLV 226


>03_05_0997 +
           29565311-29565664,29566134-29566298,29566572-29566661,
           29566763-29566891,29568141-29568272,29568904-29568969,
           29569326-29569505,29569664-29569693,29569744-29569839,
           29569959-29570096,29571060-29571142,29571447-29571484,
           29571568-29571788,29572491-29572538
          Length = 589

 Score = 48.0 bits (109), Expect = 8e-06
 Identities = 20/50 (40%), Positives = 36/50 (72%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +FD++ L E+L R +   G +K + IQ+ AI   ++G+DV+A+A++G+GK
Sbjct: 84  SFDELGLDEQLKRALRKKGLDKATPIQREAIPLILEGKDVVAKAKTGSGK 133


>07_03_1392 -
           26238885-26239007,26239137-26239235,26239636-26239720,
           26239825-26240028,26240360-26240682,26241904-26242575
          Length = 501

 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 26/56 (46%), Positives = 33/56 (58%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KTA F++ IL ++        AL LAPTRELA Q+ +   ALG  L  +C A IGG
Sbjct: 127 KTAAFALPILHRLGEDPYGVAALALAPTRELAAQLAEQFRALGAPLGLRCLAAIGG 182



 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 19/53 (35%), Positives = 33/53 (62%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V  TF ++ L + L+    + G   P+A+Q+R I   ++GRDV+  A++G+GK
Sbjct: 75  VPSTFAELGLSQWLVDVCDSLGMRVPTAVQRRCIPRALEGRDVLGIAETGSGK 127


>07_03_1566 +
           27766336-27766393,27766480-27766609,27766728-27766797,
           27767134-27767196,27767741-27767815,27768035-27768154,
           27768508-27768549,27768651-27768725,27768909-27769055,
           27769165-27769302,27769448-27769562,27769658-27769746,
           27770062-27770184
          Length = 414

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 27/58 (46%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +2

Query: 254 KTATFSISILQQI-DTSIRECQ-ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KTA F++ I+Q + +   R C  A +LAPTRELA QI K   ALG  ++ +C   IGG
Sbjct: 33  KTAAFALPIIQALLEHEHRPCFFACVLAPTRELAIQIAKQFEALGSAISLQCSVLIGG 90



 Score = 33.9 bits (74), Expect = 0.13
 Identities = 15/32 (46%), Positives = 21/32 (65%)
 Frame = +3

Query: 162 GFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           G++ P+ IQ   I   +QGRDVI   Q+G+GK
Sbjct: 2   GWKAPTRIQAEVIPFALQGRDVIGVGQTGSGK 33


>03_02_0758 +
           10954268-10954841,10955988-10957145,10957176-10957216,
           10957412-10957448,10957534-10957954,10958201-10958234
          Length = 754

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 20/57 (35%), Positives = 35/57 (61%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           D  + +++F D     +L+  I   G+EKP+ IQ +A+   + GRD+I  A++G+GK
Sbjct: 213 DVPRPIKSFADCGFPVQLMNAIAKQGYEKPTTIQCQALPIVLSGRDIIGIAKTGSGK 269


>03_01_0059 +
           484305-484617,484919-485406,485608-486092,486185-486461,
           486495-486626,486721-486893,486982-487204
          Length = 696

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 20/55 (36%), Positives = 33/55 (60%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           +F ++   +E+L  + ++GF +PS IQ  A  P ++G+  I   QSG+GK L  L
Sbjct: 241 SFKEIGCSDEILGALRSFGFPRPSHIQAMAYRPVLEGKSCIIGDQSGSGKTLAYL 295


>08_02_0671 -
           19890187-19890295,19891186-19891320,19891551-19891917,
           19892909-19893044,19894924-19894974,19895053-19895134,
           19895801-19895853,19895989-19896065,19896234-19896273,
           19897666-19897767,19897989-19898031,19898127-19899288,
           19899902-19900271
          Length = 908

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/49 (38%), Positives = 32/49 (65%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+ M L EE+ RG+   G+  P+ IQ++A+   + G D+ A A++G+GK
Sbjct: 28  FESMGLCEEVYRGVRHKGYRVPTPIQRKAMPLILAGHDIAAMARTGSGK 76



 Score = 38.3 bits (85), Expect = 0.006
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 2/68 (2%)
 Frame = +2

Query: 254 KTATFSISILQQI--DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427
           KTA F + ++Q++    +    +ALIL+PTR+LA Q  K    LG   + K    +GG +
Sbjct: 76  KTAAFLVPMIQRLRRHDAGAGIRALILSPTRDLATQTLKFAQQLGKFTDLKISLIVGGDS 135

Query: 428 VREDIRQL 451
           +     +L
Sbjct: 136 MESQFEEL 143


>12_02_0340 -
           17725866-17725884,17726046-17726326,17726842-17726928,
           17727018-17727113,17728484-17728585,17728720-17728762,
           17728834-17728952,17729348-17729444,17730153-17730214,
           17730370-17730432,17730847-17730949,17731402-17731497,
           17731594-17731742,17732356-17732529,17733078-17733156,
           17733807-17733913,17733994-17734062,17734879-17735043,
           17735206-17735703
          Length = 802

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 20/50 (40%), Positives = 30/50 (60%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F ++NL   LLR   A G++KP+ IQ   I   + GRD+   A +G+GK
Sbjct: 195 SFLELNLSRPLLRACEALGYQKPTPIQAACIPLALTGRDICGSAITGSGK 244



 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 3/63 (4%)
 Frame = +2

Query: 254 KTATFSISILQQI---DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA FS+ +L+++      +   + LIL PTRELA Q+  ++  L    + +C   +GG 
Sbjct: 244 KTAAFSLPVLERLLFRPKRVPAIRVLILTPTRELAAQVHSMIEKLAQFTDIRCCLIVGGL 303

Query: 425 NVR 433
           + +
Sbjct: 304 STK 306


>08_01_0397 - 3509186-3510291,3510322-3512335
          Length = 1039

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/59 (38%), Positives = 35/59 (59%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           D  + ++T+    L  +LL  I   GFEKP +IQ +A+   + GRD I  A++G+GK L
Sbjct: 418 DVPKPIKTWVQSGLTSKLLDTIKKLGFEKPMSIQAQALPIIMSGRDCIGIAKTGSGKTL 476



 Score = 35.9 bits (79), Expect = 0.033
 Identities = 18/45 (40%), Positives = 24/45 (53%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           LI+APTREL  QI   +      L   C A  GG+ V + I +L+
Sbjct: 501 LIMAPTRELVVQIHSDIKKFSKALGINCVAIYGGSGVAQQISELK 545


>11_06_0767 +
           27121761-27123335,27123701-27123910,27124843-27124911,
           27125387-27125656,27126027-27126377,27126480-27126757,
           27126887-27128330
          Length = 1398

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 20/52 (38%), Positives = 32/52 (61%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           TF+      E+L+ I+A GF  P+ IQ +     +Q RD++A A++G+GK L
Sbjct: 605 TFEATGFPPEILQEIHAAGFLNPTPIQAQTWPVALQNRDIVAIAKTGSGKTL 656



 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 20/45 (44%), Positives = 25/45 (55%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+LAPTRELA QIQ   +  G      C    GGT+    +R+LE
Sbjct: 680 LVLAPTRELASQIQDEAVKFGRSSRVSCTCLYGGTSKGLQLRELE 724


>08_01_0353 -
           3107628-3107774,3108177-3108213,3108248-3109164,
           3109210-3110952
          Length = 947

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 23/59 (38%), Positives = 34/59 (57%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           D  + ++T+    L  +LL  I   GFEKP  IQ +A+   + GRD I  A++G+GK L
Sbjct: 279 DVPKPIKTWVQSGLTSKLLDTIKKLGFEKPMPIQAQALPIIMSGRDCIGIAKTGSGKTL 337



 Score = 36.3 bits (80), Expect = 0.025
 Identities = 18/45 (40%), Positives = 24/45 (53%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           LI+APTREL  QI   +      L   C A  GG+ V + I +L+
Sbjct: 362 LIMAPTRELVVQIHSDIKKFAKSLGINCVAIYGGSGVAQQISELK 406


>03_05_0619 -
           26180980-26181105,26181329-26181417,26181518-26181629,
           26181711-26181848,26182004-26182150,26182458-26182532,
           26182627-26182668,26183033-26183152,26183806-26183880,
           26184051-26184113,26184690-26184759,26184877-26185006,
           26185097-26185328
          Length = 472

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 19/50 (38%), Positives = 32/50 (64%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           TF ++ +  EL+    A G+++P+ IQ  AI   ++GRD+I   Q+G+GK
Sbjct: 42  TFAELGVVPELVAACDAMGWKEPTRIQAEAIPHALEGRDLIGLGQTGSGK 91



 Score = 37.9 bits (84), Expect = 0.008
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 2/60 (3%)
 Frame = +2

Query: 254 KTATFSISILQQI--DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427
           KT  F++ I+Q +      +   A +L+PTRELA QI +   ALG  +   C   +GG +
Sbjct: 91  KTGAFALPIIQALLKQDKPQALFACVLSPTRELAFQIGQQFEALGSAIGLSCTVLVGGVD 150


>03_01_0399 +
           3097878-3098141,3098254-3098547,3098659-3098886,
           3099148-3099224,3099501-3099540,3099737-3099802,
           3100305-3100706,3100777-3100888,3101445-3101530,
           3101607-3101672
          Length = 544

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 20/53 (37%), Positives = 32/53 (60%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHAC 412
           KT  F + +L ++D + +  QA+ + PTRELAQQ + V++ +G      C AC
Sbjct: 153 KTTCFVLGMLSRVDPNRKVTQAICICPTRELAQQNKSVLMRMGKFTGITC-AC 204



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 4/53 (7%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIY-AYGFEKPSAIQQRAIMPCIQG---RDVIAQAQSGTGK 257
           F+D+ L  ELL+G++   GF +PS IQ    +P I     +D+IAQA +G+GK
Sbjct: 102 FEDLKLTPELLKGLHDEMGFSRPSKIQA-VTLPMILTPPYKDLIAQAHNGSGK 153


>02_01_0381 - 2764331-2764342,2768966-2769907
          Length = 317

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 25/73 (34%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +3

Query: 57  REWTLGHLHTDWDQV---VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDV 227
           R+W   H+  D D V      F D+ L E +LR +   G  +P+ IQ + +   + GRD+
Sbjct: 166 RKW---HILVDGDDVPPPARDFRDLRLPEPMLRKLREKGIVQPTPIQVQGLPVVLSGRDM 222

Query: 228 IAQAQSGTGKLLL 266
           I  A +G+GK L+
Sbjct: 223 IGIAFTGSGKTLV 235


>06_03_0674 +
           23422004-23422552,23423295-23423369,23424360-23424443,
           23424749-23424991,23425348-23425515,23425608-23425727,
           23426372-23427016
          Length = 627

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 18/49 (36%), Positives = 32/49 (65%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+   L E +LR +   G+E P+ +Q+ ++   + GRD++A AQ+G+GK
Sbjct: 86  FEAAGLVEAVLRNVARCGYESPTPVQRYSMPIALAGRDLMACAQTGSGK 134


>03_06_0365 -
           33399422-33399925,33400470-33400583,33400762-33400929,
           33401305-33401547,33402148-33402231,33402323-33403098,
           33404423-33404636
          Length = 700

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 26/69 (37%), Positives = 39/69 (56%)
 Frame = +3

Query: 51  DLREWTLGHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVI 230
           D+   T GH   D    V TF +++L + L   I    + KP+ +Q+ AI   I GRD++
Sbjct: 222 DIPVETSGH---DVPPPVNTFAEIDLGDALNENIRRCKYVKPTPVQRYAIPISIAGRDLM 278

Query: 231 AQAQSGTGK 257
           A AQ+G+GK
Sbjct: 279 ACAQTGSGK 287



 Score = 33.1 bits (72), Expect = 0.23
 Identities = 16/46 (34%), Positives = 24/46 (52%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           ALIL+PTREL+ QI +           +     GG  + + +R+LE
Sbjct: 318 ALILSPTRELSVQIHEEARKFAYQTGVRVVVAYGGAPIHQQLRELE 363


>01_01_0682 -
           5244805-5244919,5246468-5246613,5246813-5246994,
           5247069-5247295,5247382-5247467,5247564-5247656,
           5247964-5248118,5248407-5248490,5248589-5248768,
           5249587-5249828,5249927-5249982
          Length = 521

 Score = 41.1 bits (92), Expect = 9e-04
 Identities = 22/62 (35%), Positives = 35/62 (56%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLL 266
           D  + V  F D+   E +L+ I   GF +P+ IQ +     ++GRD+I  A++G+GK L 
Sbjct: 85  DVPKPVREFRDVGFPEYVLQEITKAGFVEPTPIQSQGWPMALRGRDLIGIAETGSGKTLA 144

Query: 267 SL 272
            L
Sbjct: 145 YL 146



 Score = 28.3 bits (60), Expect = 6.6
 Identities = 13/21 (61%), Positives = 15/21 (71%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALG 382
           L+LAPTRELA QIQ+     G
Sbjct: 168 LVLAPTRELAVQIQQEATKFG 188


>03_05_0865 - 28365430-28367640
          Length = 736

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 20/49 (40%), Positives = 31/49 (63%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           + +  L  ELLR +   G+++PS IQ  +I   +Q RDVI  A++G+GK
Sbjct: 317 WSESKLGTELLRAVEKAGYKEPSPIQMASIPLGLQQRDVIGIAETGSGK 365



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 16/40 (40%), Positives = 27/40 (67%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVRE 436
           A+++APTRELAQQI++  +    +L  K  + +GG ++ E
Sbjct: 394 AVVMAPTRELAQQIEEETVKFATYLGIKVVSIVGGQSIEE 433


>01_05_0721 +
           24594815-24594834,24595207-24595313,24595417-24595472,
           24595562-24595810,24595871-24596077,24596157-24596243,
           24596331-24596426,24596500-24596715,24596908-24597090,
           24597222-24597449
          Length = 482

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 17/54 (31%), Positives = 33/54 (61%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           FD   +    L+ +   G+E+ + +Q+  +   +QG+DV+A+A++GTGK +  L
Sbjct: 8   FDQCTISPLSLKAVKDAGYERMTQVQEATLPVILQGKDVLAKAKTGTGKTVAFL 61



 Score = 27.9 bits (59), Expect = 8.7
 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = +2

Query: 320 LILAPTRELAQQIQ-KVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L++ PTRELA Q+  +    L  H +      IGGT + ++ R ++
Sbjct: 86  LVMCPTRELAIQVAVEAKKLLKYHRSLGVQVVIGGTRLTQEQRSMQ 131


>01_06_1758 -
           39681942-39682030,39682115-39682345,39682643-39682679,
           39683604-39683835,39683937-39684022,39684126-39684218,
           39684302-39684465,39684541-39684702,39684783-39684962,
           39685079-39685515,39685614-39685669
          Length = 588

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 20/59 (33%), Positives = 33/59 (55%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           D  + V  F + N  +  ++ I   GF +P+ IQ +     ++GRD+I  AQ+G+GK L
Sbjct: 150 DVPKPVRYFQEANFPDYCMQAIAKSGFVEPTPIQSQGWPMALKGRDMIGIAQTGSGKTL 208



 Score = 32.7 bits (71), Expect = 0.31
 Identities = 19/44 (43%), Positives = 22/44 (50%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           LILAPTRELA QIQ+     G +   +     GG      IR L
Sbjct: 233 LILAPTRELAVQIQQESGKFGSYSRTRSTCIYGGAPKGPQIRDL 276


>01_01_0602 -
           4484972-4485450,4485949-4485997,4486108-4486237,
           4486636-4486778,4486819-4486877,4487167-4487200,
           4487489-4487629,4487719-4487907,4488027-4488122,
           4488163-4488225,4488588-4489097
          Length = 630

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 18/59 (30%), Positives = 34/59 (57%)
 Frame = +3

Query: 96  QVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           +VV++F+++ L EE++  +   G  KP+ IQ   +   + G  V+  + +G+GK L  L
Sbjct: 107 EVVDSFEELGLGEEVMAALGEMGISKPTEIQCVGVPAVLAGTSVVLGSHTGSGKTLAYL 165



 Score = 33.9 bits (74), Expect = 0.13
 Identities = 14/43 (32%), Positives = 25/43 (58%)
 Frame = +2

Query: 305 RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           R  +A++L PTREL +Q+ +V  ++  H   +     GG+ +R
Sbjct: 207 RRPRAVVLCPTRELTEQVFRVAKSISHHARFRSTMVSGGSRIR 249


>01_01_0509 -
           3713109-3713244,3713689-3713733,3713959-3714015,
           3714088-3714438,3714585-3714862,3714939-3715289,
           3715378-3715647,3716035-3716103,3716194-3716304,
           3716503-3716583,3716825-3716914,3717032-3717262
          Length = 689

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 18/52 (34%), Positives = 30/52 (57%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           TF       E+LR +   GF  P+ IQ ++    ++ RD++A A++G+GK L
Sbjct: 181 TFQSTGFPPEILREVQQAGFSAPTPIQAQSWPIALRNRDIVAVAKTGSGKTL 232



 Score = 29.5 bits (63), Expect = 2.8
 Identities = 17/45 (37%), Positives = 20/45 (44%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+L+PTRELA QIQ      G           GG      +R LE
Sbjct: 256 LVLSPTRELATQIQDEAKKFGRSSRISSVCLYGGAPKGPQLRDLE 300


>07_01_0725 -
           5532803-5533324,5533631-5533657,5534285-5534398,
           5534564-5534731,5535951-5536193,5537178-5537261,
           5537357-5538117,5539637-5539730,5540633-5540899,
           5541311-5541316,5542538-5542657
          Length = 801

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 25/69 (36%), Positives = 38/69 (55%)
 Frame = +3

Query: 51  DLREWTLGHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVI 230
           D+   T GH   D      TF +++L + L   I    + KP+ +Q+ AI   I GRD++
Sbjct: 308 DIPVETSGH---DVPPPANTFAEIDLGDALNENIRRCKYVKPTPVQRYAIPISIAGRDLM 364

Query: 231 AQAQSGTGK 257
           A AQ+G+GK
Sbjct: 365 ACAQTGSGK 373



 Score = 33.9 bits (74), Expect = 0.13
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           ALIL+PTREL+ QI +           K     GG  + + +R+LE
Sbjct: 404 ALILSPTRELSVQIHEEARKFAYQTGVKVVVAYGGAPITQQLRELE 449


>01_05_0722 +
           24598426-24598649,24599113-24599219,24599319-24599374,
           24599469-24599675,24599757-24599963,24600037-24600123,
           24600167-24600208,24600209-24600304,24600406-24600621,
           24600693-24600875,24601014-24601241
          Length = 550

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           FD   +    L+ I   G+EK + +Q+  +   +QG DV+A+A++GTGK +  L
Sbjct: 76  FDQCPVSPLSLKAIKDAGYEKMTQVQEATLPIILQGEDVLAKAKTGTGKTVAFL 129



 Score = 31.5 bits (68), Expect = 0.70
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 3/70 (4%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRE--CQALILAPTRELAQQI-QKVVIALGDHLNAKCHACIGGT 424
           KT  F +  ++ + T  R      L++ PTRELA Q+  +    L  H +      IGGT
Sbjct: 124 KTVAFLLPAIELLSTLPRSPSINLLVICPTRELANQVAAEARKLLKYHRSLGVQVVIGGT 183

Query: 425 NVREDIRQLE 454
            + ++ R ++
Sbjct: 184 KLPQEQRSMQ 193


>07_03_0601 -
           19872780-19873099,19873148-19873151,19874196-19874357,
           19874429-19874617,19874687-19875010,19875103-19875378,
           19875436-19875478,19876110-19876188,19876473-19876555,
           19876708-19876782,19877324-19877490,19877960-19878370
          Length = 710

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           FD++ L  +   G+   G+ + S IQ+ A+   + GRDV+  A++G+GK L
Sbjct: 82  FDELPLSNKTKDGLRKAGYTEMSEIQRAALPHALCGRDVLGAAKTGSGKTL 132


>02_05_1293 -
           35520733-35520963,35521696-35521878,35522040-35522255,
           35522936-35523022,35523125-35523331,35523426-35523650,
           35523743-35523798,35524009-35524115,35524443-35525470
          Length = 779

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 13/49 (26%), Positives = 32/49 (65%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F++  +    ++ +   G+ + + +Q+ A+  C++G+DV+ +A++GTGK
Sbjct: 344 FEECGISPLTVKALTDAGYVQTTVVQETALPMCLEGKDVLVKAKTGTGK 392



 Score = 33.5 bits (73), Expect = 0.17
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
 Frame = +2

Query: 317 ALILAPTRELAQQI-QKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           +LIL PTRELA Q+  +  + L  H      + IGGT  + D R+LE
Sbjct: 421 SLILCPTRELAIQLTAEANVLLKYHQGIGVQSLIGGTRFKLDQRRLE 467


>12_02_1076 -
           25862671-25863159,25863290-25863451,25863614-25863838,
           25863939-25864037,25864584-25864992,25865094-25865221,
           25865955-25866329
          Length = 628

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 19/45 (42%), Positives = 28/45 (62%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           A++LAPTRELA+Q+++      D  N +     GGT + + IRQL
Sbjct: 175 AIVLAPTRELAKQVER---EFSDSSNVETICVYGGTPISQQIRQL 216



 Score = 35.9 bits (79), Expect = 0.033
 Identities = 14/48 (29%), Positives = 30/48 (62%)
 Frame = +3

Query: 120 MNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           + +  +++  + + G  K   IQ+  + P +QG+D++ +A++GTGK L
Sbjct: 103 LGISPKIVSQLASRGITKLFPIQRAVLEPAMQGKDMVGRAKTGTGKTL 150


>01_05_0296 +
           20567259-20567386,20568895-20569123,20569205-20569436,
           20569583-20569701,20570321-20570377,20570455-20570639,
           20571416-20571560,20571630-20571713,20571798-20571861,
           20571889-20571932
          Length = 428

 Score = 37.9 bits (84), Expect = 0.008
 Identities = 24/62 (38%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F +S LQQID    +  AL+L  TRELA QI         +L   K     GG ++
Sbjct: 86  KTAVFVLSSLQQIDPVAGQVGALVLCHTRELAYQICHEFERFSKYLPEVKVAVFYGGVHI 145

Query: 431 RE 436
           ++
Sbjct: 146 KK 147


>01_05_0295 +
           20537147-20537291,20539111-20539283,20539365-20539596,
           20539743-20539861,20540480-20540536,20540615-20540799,
           20542252-20542396,20542463-20542546,20542634-20542697,
           20542799-20542809
          Length = 404

 Score = 37.9 bits (84), Expect = 0.008
 Identities = 24/62 (38%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F +S LQQID    +  AL+L  TRELA QI         +L   K     GG ++
Sbjct: 73  KTAVFVLSSLQQIDPVAGQVGALVLCHTRELAYQICHEFERFSKYLPEVKVAVFYGGVHI 132

Query: 431 RE 436
           ++
Sbjct: 133 KK 134


>01_05_0292 +
           20518668-20519090,20519213-20519281,20520204-20520473,
           20520734-20521084,20521251-20521528,20522755-20523099,
           20523346-20523911,20525155-20525528
          Length = 891

 Score = 37.5 bits (83), Expect = 0.011
 Identities = 18/54 (33%), Positives = 32/54 (59%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           + +F+      E+L+ I   GF  P+ IQ ++    +Q +DV+A A++G+GK L
Sbjct: 149 ITSFETGGFPPEILKEIQRAGFSSPTPIQAQSWPIALQCQDVVAIAKTGSGKTL 202



 Score = 30.3 bits (65), Expect = 1.6
 Identities = 16/45 (35%), Positives = 21/45 (46%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+LAPTRELA QI +  +  G           GG      +R L+
Sbjct: 226 LVLAPTRELATQILEEAVKFGRSSRISSTCLYGGAPKGPQLRDLD 270


>11_06_0300 +
           22095396-22096145,22096261-22096344,22097062-22097304,
           22098535-22098702,22098895-22099008,22099378-22099890
          Length = 623

 Score = 37.1 bits (82), Expect = 0.014
 Identities = 19/52 (36%), Positives = 33/52 (63%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V TF +++L + L   I    + +P+ +Q+ AI   + GRD++A AQ+G+GK
Sbjct: 154 VGTFAEIDLGQALNDNIRRCKYVRPTPVQRYAIPISLAGRDLMACAQTGSGK 205



 Score = 33.1 bits (72), Expect = 0.23
 Identities = 16/46 (34%), Positives = 23/46 (50%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           ALIL+PTREL+ QI +           +     GG  + + +R LE
Sbjct: 238 ALILSPTRELSMQIHEEARKFSYQTGVRVVVAYGGAPINQQLRDLE 283


>01_07_0333 -
           42813789-42814073,42814229-42814315,42815083-42815172,
           42815555-42815623,42815859-42815888,42816060-42816164,
           42816454-42816549,42816647-42816760,42816862-42816955,
           42817027-42817190
          Length = 377

 Score = 37.1 bits (82), Expect = 0.014
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +2

Query: 224 CYRSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKV 367
           C   +   + KT  + +S+   ID      QAL++ PTREL  Q+ KV
Sbjct: 81  CILHAQTGSGKTLAYLLSVFSAIDFGRSSVQALVVVPTRELGMQVTKV 128



 Score = 35.5 bits (78), Expect = 0.043
 Identities = 22/67 (32%), Positives = 38/67 (56%), Gaps = 6/67 (8%)
 Frame = +3

Query: 132 EELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK---LLLSLYR---FYNKS 293
           E +L+     G+  P+ +Q++++   + G+D I  AQ+G+GK    LLS++    F   S
Sbjct: 50  EHVLQRAEEVGYVVPTEVQEQSLPVLLSGQDCILHAQTGSGKTLAYLLSVFSAIDFGRSS 109

Query: 294 IQAFVNV 314
           +QA V V
Sbjct: 110 VQALVVV 116


>07_03_1500 +
           27001842-27002058,27002144-27002283,27002458-27002549,
           27002680-27002776,27002871-27002951,27003031-27003263,
           27003876-27004070,27004149-27004239,27004324-27004446,
           27004542-27004692,27005060-27005262
          Length = 540

 Score = 36.3 bits (80), Expect = 0.025
 Identities = 17/46 (36%), Positives = 29/46 (63%)
 Frame = +3

Query: 138 LLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLY 275
           L+  +   GF++P+ IQ++AI   + GR+  A A +G+GK L  L+
Sbjct: 157 LVGNLSKLGFQEPTPIQRQAIPILLSGRECFACAPTGSGKTLAFLF 202



 Score = 35.9 bits (79), Expect = 0.033
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 1/45 (2%)
 Frame = +2

Query: 224 CYRSSPVRNWKTATFSISILQQIDTSIRE-CQALILAPTRELAQQ 355
           C+  +P  + KT  F   IL +I    +E  +A+IL PTRELA Q
Sbjct: 186 CFACAPTGSGKTLAFLFPILMKIKPGSKEGVKAVILCPTRELAAQ 230


>04_04_0476 -
           25508952-25509004,25509245-25509326,25509453-25509611,
           25509702-25509767,25509898-25510067,25510172-25510262,
           25510331-25510410,25510887-25511003,25511092-25511218,
           25511685-25511865,25511978-25512366,25512959-25513135,
           25513306-25513500,25513844-25514031,25514192-25514500,
           25514592-25514637
          Length = 809

 Score = 35.9 bits (79), Expect = 0.033
 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 2/56 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI--QGRDVIAQAQSGTGKLL 263
           V  + ++ L   L+  +   GF++P+ IQ +A  P    QG+DVI  A++G+GK L
Sbjct: 141 VYAWRELRLHPLLITAVRRLGFKEPTPIQ-KACFPAAAHQGKDVIGAAETGSGKTL 195



 Score = 29.5 bits (63), Expect = 2.8
 Identities = 16/47 (34%), Positives = 26/47 (55%)
 Frame = +2

Query: 314 QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           +ALIL PTRELA+Q+   +      L  +    +GG ++ +  R L+
Sbjct: 233 RALILTPTRELAKQVCDHLKEAAKFLRIQVVPIVGGLSMEKQERLLK 279


>02_01_0765 -
           5694535-5694644,5695039-5696550,5697229-5697390,
           5698015-5698057
          Length = 608

 Score = 35.5 bits (78), Expect = 0.043
 Identities = 17/46 (36%), Positives = 27/46 (58%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           A++LAPTREL  Q+++    LG  L  K    +GG  + + I ++E
Sbjct: 260 AIVLAPTRELCLQVEEQAKVLGKGLPFKTALVVGGDPLAQQIYRIE 305


>05_01_0079 +
           531617-531734,531987-532059,532152-532261,532400-532543,
           532628-532736,532836-533182,533260-533333,533478-533782,
           534168-534294,534385-534414,534589-534837
          Length = 561

 Score = 35.1 bits (77), Expect = 0.057
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 1/56 (1%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIY-AYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           +F D+ L   L   +    GF+ P+ IQ +AI   + G+ ++ +A +GTGK L  L
Sbjct: 24  SFTDLGLHPTLCAHLQDKMGFQAPTRIQAQAIPVAMSGQHMLVKAATGTGKTLAYL 79


>07_01_0322 -
           2258067-2258519,2258620-2258781,2258896-2259159,
           2259196-2259294,2259723-2260131,2260223-2260350,
           2261115-2261181,2262766-2262838,2262911-2263130
          Length = 624

 Score = 34.7 bits (76), Expect = 0.076
 Identities = 17/52 (32%), Positives = 32/52 (61%), Gaps = 2/52 (3%)
 Frame = +3

Query: 114 DDMNLKEELLRGIYAYGFEKPSAIQ-QRAIM-PCIQGRDVIAQAQSGTGKLL 263
           + + L +     I       PS+++ +RA++ P +QG+D+I +A++GTGK L
Sbjct: 94  ESLELGQACCGSIMVDSITPPSSVETERAVLDPAMQGKDMIGRARTGTGKTL 145



 Score = 32.7 bits (71), Expect = 0.31
 Identities = 20/43 (46%), Positives = 27/43 (62%), Gaps = 6/43 (13%)
 Frame = +2

Query: 254 KTATFSISILQQI------DTSIRECQALILAPTRELAQQIQK 364
           KT  F I I+ +I      + S R   A+ILAPTRELA+Q++K
Sbjct: 143 KTLAFGIPIMDRILRHNEKNGSGRNPLAIILAPTRELARQVEK 185


>03_06_0344 -
           33276366-33276548,33277044-33277169,33277254-33277322,
           33277401-33277505,33277595-33277633,33277717-33278016,
           33278093-33278182,33278271-33278312,33278433-33278516,
           33278762-33278947,33279218-33279403,33279663-33280025
          Length = 590

 Score = 34.7 bits (76), Expect = 0.076
 Identities = 17/54 (31%), Positives = 29/54 (53%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           F ++ + E   R I    +   + IQ R+I   + G+DV+  A++G+GK L  L
Sbjct: 98  FSELGVSEPTARAIREMNYTYLTQIQARSIPHLLNGKDVMGAAKTGSGKTLAFL 151


>09_03_0167 +
           12965030-12965356,12966100-12966387,12966704-12966826,
           12967229-12967611,12967863-12968190,12968324-12968353,
           12968837-12968989,12969510-12969815
          Length = 645

 Score = 33.5 bits (73), Expect = 0.17
 Identities = 18/69 (26%), Positives = 36/69 (52%), Gaps = 4/69 (5%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK----LLLSLY 275
           +++ + + + L   ++  G  +PS +Q   I   +   DVI  A++G+GK    L+  + 
Sbjct: 83  SWESLGVSDRLASALHGAGLARPSLVQAACIPHVLTTNDVIVAAETGSGKTHGYLVPLIE 142

Query: 276 RFYNKSIQA 302
           +  +KSI A
Sbjct: 143 KLCSKSISA 151


>07_02_0023 -
           11918735-11918827,11919139-11919231,11919320-11919484,
           11920234-11920327,11921012-11921136,11921228-11921313,
           11921786-11921864,11923777-11923857,11924153-11924260,
           11924870-11924994,11925110-11925530
          Length = 489

 Score = 33.1 bits (72), Expect = 0.23
 Identities = 16/34 (47%), Positives = 21/34 (61%)
 Frame = +3

Query: 162 GFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           GFE+PS IQ  A    + GRD I  A +G+GK +
Sbjct: 111 GFERPSPIQAYAWPYLLDGRDFIGIAATGSGKTI 144



 Score = 33.1 bits (72), Expect = 0.23
 Identities = 24/74 (32%), Positives = 32/74 (43%), Gaps = 7/74 (9%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQA-------LILAPTRELAQQIQKVVIALGDHLNAKCHAC 412
           KT  F +  L  +   + E  A       L+L+PTRELAQQI  V+   G          
Sbjct: 142 KTIAFGVPALMHVRRKMGEKSAKKGVPRVLVLSPTRELAQQIADVLCEAGAPCGISSVCL 201

Query: 413 IGGTNVREDIRQLE 454
            GGT+    I  L+
Sbjct: 202 YGGTSKGPQISALK 215


>03_06_0531 +
           34552206-34552598,34552665-34552735,34553363-34553369,
           34553603-34553736,34553834-34554245,34554655-34554753,
           34555059-34555283,34555652-34556029,34556412-34556555,
           34556832-34556927,34557228-34557547,34557965-34558040
          Length = 784

 Score = 32.3 bits (70), Expect = 0.40
 Identities = 12/22 (54%), Positives = 19/22 (86%)
 Frame = +3

Query: 198 IMPCIQGRDVIAQAQSGTGKLL 263
           ++P + GRD+IA+A++GTGK L
Sbjct: 161 LIPALDGRDLIARAKTGTGKTL 182



 Score = 31.9 bits (69), Expect = 0.53
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 8/58 (13%)
 Frame = +2

Query: 254 KTATFSISILQQI-----DTSIRECQ---ALILAPTRELAQQIQKVVIALGDHLNAKC 403
           KT  F I +++Q+       S+R  +    L+LAPTRELA+Q++K +      L+  C
Sbjct: 180 KTLAFGIPMIKQLMEEDDGRSVRRGRIPRVLVLAPTRELAKQVEKEIKESAPKLSTVC 237


>02_05_0498 - 29520062-29520758,29521552-29521860,29523525-29524735
          Length = 738

 Score = 31.9 bits (69), Expect = 0.53
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 6/65 (9%)
 Frame = -3

Query: 602 GSG-PLKTSGTTFSSASSRTKSLMV---LA*KRTTIIISYT--RPWSAHHVHEHHSPVGE 441
           G+G P +  G T S+AS R K++ V   +   +T ++++ T  R    HH H H  P GE
Sbjct: 661 GAGEPREPDGGTLSAASIRKKAIEVGSHVDALQTGMMVAPTHHREQQKHHHHPHLQPHGE 720

Query: 440 YLHGH 426
             H H
Sbjct: 721 EQHHH 725


>07_03_0114 + 13571305-13571553
          Length = 82

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 17/56 (30%), Positives = 30/56 (53%)
 Frame = +3

Query: 3   QRIPKMGHRRIKVVTMDLREWTLGHLHTDWDQVVETFDDMNLKEELLRGIYAYGFE 170
           + + + GHR++K   + ++E     L T+ D+V E      L+E LLR   A+G +
Sbjct: 2   ESLERRGHRKLKKWILLIKEIQFLALKTEIDEVDEGISKGELEEALLRRRNAHGIK 57


>02_05_1118 +
           34241819-34242217,34242350-34242522,34243499-34243660,
           34243762-34243903,34244320-34244544,34244649-34244711,
           34244817-34244891,34245198-34245404,34247274-34247465,
           34247515-34247634
          Length = 585

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
 Frame = -2

Query: 537 DGVGMKAHDDYHIIYTTLECPPRT*TPLSSWRISSRTLVPPMQAWHLAF-K*SPRAITTF 361
           D   ++  DDY +    L C      PL++   S + +V  +Q W +AF   SPR +  F
Sbjct: 122 DAFRIEFGDDYRVFVKDL-CKDHAGWPLNNMESSYKFMVKHVQLWKVAFHTTSPRWVHCF 180

Query: 360 *ICWASSLVGARIKA 316
            +   +S    +++A
Sbjct: 181 YLAALASFYAKKVEA 195


>01_01_0447 -
           3327727-3328144,3328438-3328688,3328820-3328909,
           3329061-3329159,3329240-3329353,3329450-3329555,
           3329661-3329740,3329913-3330173,3330271-3330507,
           3330635-3330922
          Length = 647

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 14/46 (30%), Positives = 25/46 (54%)
 Frame = +3

Query: 126 LKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           L  E+++ +   GF + + +Q  AI   +  +DV   A +G+GK L
Sbjct: 30  LSPEVVKALKGGGFRRCTPVQAAAIPLLLSHKDVAVDAATGSGKTL 75



 Score = 28.7 bits (61), Expect = 5.0
 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = +2

Query: 308 ECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNVREDIRQLE 454
           E   +I++PTREL+ QI  V       L        +GG +++ ++++LE
Sbjct: 96  EVLGIIISPTRELSSQIYNVAQPFFATLKGVSSMLLVGGFDIKAELKKLE 145


>02_01_0505 + 3676117-3676890
          Length = 257

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 19/58 (32%), Positives = 27/58 (46%)
 Frame = +3

Query: 147 GIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRFYNKSIQAFVNVKL 320
           G +A+ +   +A+Q R +    + R  + Q    TG LLL      NKS  A   VKL
Sbjct: 50  GGFAHSYGLEAAMQSRMVNNPEELRSFVVQVLENTGSLLLPFVCCANKSPDAATWVKL 107


>01_04_0048 - 15421003-15422355
          Length = 450

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 2/69 (2%)
 Frame = +1

Query: 463 SCTWWALQGRVYDMIIVVRFHANTIKLFVLD--EADENVVPEVFKGPDPLMVFKMVGQLI 636
           S  + A QG++Y   I V F  N  ++FV+D    + N     F  P+P +      + +
Sbjct: 256 SWKYMAFQGKIYAASIWVNFSPN--RIFVIDPPRVEANGSASSFSLPEPKLFATCPVEKL 313

Query: 637 VSSQYLLSC 663
               YL++C
Sbjct: 314 FGFAYLVNC 322


>09_02_0088 +
           4136698-4136857,4137530-4137558,4137992-4138954,
           4138973-4139301,4139398-4139485,4139766-4139864,
           4139935-4140245,4140532-4140685
          Length = 710

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 10/25 (40%), Positives = 13/25 (52%)
 Frame = +2

Query: 182 NPATRNNALHPRTRCYRSSPVRNWK 256
           NP T + A H R   Y   P +NW+
Sbjct: 28  NPTTEDTANHGRRTAYHFQPAKNWQ 52


>06_03_0337 +
           19678152-19678484,19678616-19678801,19679232-19679417,
           19680840-19680926,19681045-19681086,19681164-19681253,
           19681399-19681503,19681797-19681835,19681914-19682018,
           19682463-19682531,19682587-19682736,19683156-19683335
          Length = 523

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 16/44 (36%), Positives = 23/44 (52%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           ++L PTRELA Q   V   L  + +      IGG ++R +  QL
Sbjct: 162 IVLCPTRELAIQTHNVAKELMRYHSQTLGYVIGGIDLRGEAEQL 205


>02_02_0619 -
           12205718-12205845,12205941-12206142,12207240-12207315,
           12208073-12208278
          Length = 203

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = -3

Query: 203 HYCALLDCRRFFKTIGVYASQQFFFEVHVIEG 108
           ++C +L C+R   + G +++QQ FF   +I G
Sbjct: 118 YHCNILGCKRLNDSTGEHSTQQRFFVELIING 149


>04_04_1377 - 33064906-33065607
          Length = 233

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 25/76 (32%), Positives = 36/76 (47%), Gaps = 11/76 (14%)
 Frame = -3

Query: 599 SGPLKTSGTTFSSASSRTKSLMV---LA*KRTTIIISYT----RPWSAHHVHEHH----S 453
           S P +  G T S+AS R K++ V   +   +T ++++ T         HH H HH     
Sbjct: 134 SEPREPDGGTLSAASIRKKAIEVGSRVDALQTGMMVAPTTHHRERQKHHHHHHHHHPHLQ 193

Query: 452 PVGEYLHGHWCHQCKH 405
           P GE  H H  H+ KH
Sbjct: 194 PHGEEQHHH--HEQKH 207


>10_06_0143 -
           11183574-11183761,11183989-11184344,11184437-11184592,
           11184825-11184994,11185906-11186064,11186856-11187164,
           11187281-11187576,11187825-11188174,11188279-11188434,
           11188634-11188803,11189289-11189447,11190702-11191010,
           11191172-11191458,11191911-11192263,11192366-11192521,
           11192680-11192849,11195800-11195958,11196937-11197254,
           11197658-11197786
          Length = 1449

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 23/82 (28%), Positives = 35/82 (42%), Gaps = 4/82 (4%)
 Frame = -1

Query: 490 DPGVPTTYMNTTLQ-LANIFTDIGATNASMAFSIQVITKSYH---HLLNLLGQLSCGSQD 323
           DP  P  ++  +LQ L N F      N  +   +     S +   H  +  G L  G+  
Sbjct: 714 DPNPPAPFVGGSLQALDNAFKWAEKYNIGIIVDLHAAPGSQNRLDHSASRDGSLEWGTSA 773

Query: 322 QSLTFTNACIDLL*NRYRESSS 257
            ++  T   ID L +RY +SSS
Sbjct: 774 ANIAQTVGVIDFLASRYAKSSS 795


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,284,326
Number of Sequences: 37544
Number of extensions: 504299
Number of successful extensions: 1560
Number of sequences better than 10.0: 60
Number of HSP's better than 10.0 without gapping: 1407
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1554
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1898162308
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).