SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30048
         (717 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

09_04_0160 + 15226762-15227032,15227138-15227373,15227469-152275...    31   0.91 
07_03_1767 + 29338867-29338912,29339261-29339325,29339571-293396...    29   2.8  
05_01_0171 - 1186239-1186322,1186395-1186475                           28   6.4  
03_01_0085 + 690618-691012,691114-691193,691775-691959,692363-69...    28   8.5  
02_01_0201 - 1347868-1347925,1348040-1348135,1348447-1348523,134...    28   8.5  

>09_04_0160 +
           15226762-15227032,15227138-15227373,15227469-15227565,
           15227657-15227783,15227870-15228482,15228572-15228835,
           15228918-15229130,15229253-15229460,15229552-15229748,
           15229830-15230183,15230287-15230874
          Length = 1055

 Score = 31.1 bits (67), Expect = 0.91
 Identities = 22/81 (27%), Positives = 36/81 (44%)
 Frame = +1

Query: 340 PDAEAKSADIKVEEPAAQPEDSKTEVASLTVAEISIRRNT*LLLMAEGSVRLRLASLRTM 519
           PD +   AD+ + + A QP   K  +AS   ++++  R   +L +      LR   L  +
Sbjct: 233 PDPDDYDADVPLNDEARQPLSRKVSIAS---SKVNPYRMVIILRLVVLGFFLRYRILHPV 289

Query: 520 VKARFDLWLLPVAKRCWLAIS 582
             A   LWL  +    W A+S
Sbjct: 290 PDA-IPLWLTSIICEIWFAVS 309


>07_03_1767 + 29338867-29338912,29339261-29339325,29339571-29339642,
            29339913-29339956,29340047-29340158,29340879-29340950,
            29341449-29341511,29341957-29342034,29342110-29342202,
            29342294-29342413,29342762-29342845,29343094-29343309,
            29343401-29343448,29343761-29343871,29344170-29344267,
            29345004-29345248,29345764-29345832,29345919-29345983,
            29346168-29346337,29346434-29346512,29346614-29346869,
            29347416-29347461,29347602-29347710,29347820-29347882,
            29350075-29350107,29350924-29351442
          Length = 991

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 3/64 (4%)
 Frame = -3

Query: 664  GLPLQPHQGMVWLNLKEPSTAA---RSLNFRKLPASIALLQVGAKGRI*LSPWCEDWQV* 494
            G P   H   +      PS+++   R L+   LPAS  ++  G  GR   S W   W V 
Sbjct: 886  GPPASHHMMRLLTGCASPSSSSFRFRPLSVHALPASDVVIAEGITGRYHDSYWVHAWTVG 945

Query: 493  VGQN 482
             G N
Sbjct: 946  PGPN 949


>05_01_0171 - 1186239-1186322,1186395-1186475
          Length = 54

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 17/43 (39%), Positives = 28/43 (65%), Gaps = 2/43 (4%)
 Frame = -3

Query: 328 ILLP--GLFLRFSLQERFPVSRYRSLLGYIVLFGLWYSGYLVV 206
           ILLP  G+FLR+ +   F ++   ++LGY  L G+ Y+ Y++V
Sbjct: 13  ILLPPLGVFLRYGIGMEFWIALLLTILGY--LPGIIYAVYVLV 53


>03_01_0085 + 690618-691012,691114-691193,691775-691959,692363-693320,
            693391-693518,693951-694010,694113-694163,694704-694821,
            694990-695915,695916-697707,697810-697943,698029-698526
          Length = 1774

 Score = 27.9 bits (59), Expect = 8.5
 Identities = 14/57 (24%), Positives = 25/57 (43%)
 Frame = +1

Query: 250  SPEDSDIAXXXXXXXXXXXXXXXXAKSSEIPDAEAKSADIKVEEPAAQPEDSKTEVA 420
            SP++ DI                  +S  +P++ + + DIK E+P+  P     EV+
Sbjct: 1291 SPDNHDIKCEYSSPTPIPESKELSLQSKILPESSSDNQDIKCEDPSPTPISKSKEVS 1347


>02_01_0201 -
           1347868-1347925,1348040-1348135,1348447-1348523,
           1349385-1349453,1349576-1349629,1350295-1350350,
           1350487-1350694,1350978-1351066,1351163-1351187
          Length = 243

 Score = 27.9 bits (59), Expect = 8.5
 Identities = 14/42 (33%), Positives = 25/42 (59%)
 Frame = -2

Query: 449 LIEISATVRLATSVFESSG*AAGSSTLISADFASASGISDDF 324
           ++ I+A +   T +F+SS  +A  +  ++A FA AS   D+F
Sbjct: 55  VVVIAAGLSSCTYIFDSSDASASGAADVAATFAKASRKMDEF 96


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,123,221
Number of Sequences: 37544
Number of extensions: 309267
Number of successful extensions: 709
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 695
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 709
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1862792824
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).