SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30047
         (794 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_01_0924 + 7301611-7301737,7301890-7302518                           32   0.60 
02_03_0205 - 16411707-16412759,16413077-16413256,16413960-164144...    31   1.1  
11_04_0383 - 17004520-17005150,17005205-17005327,17005641-17007142     30   1.8  
10_08_0235 - 16076133-16076411,16076457-16076972                       30   2.4  
02_03_0214 + 16504237-16504251,16504447-16505055                       30   2.4  
05_01_0263 + 2020328-2020543,2020715-2021039,2021612-2022063           29   3.2  
04_01_0369 + 4840371-4841294,4841921-4842559                           29   4.3  
10_02_0096 - 5248369-5248479,5248562-5248604,5249093-5249178,525...    28   7.4  
11_04_0313 + 16270807-16272271,16272713-16274140,16274289-16274788     28   9.8  
11_01_0145 + 1204021-1204296,1204430-1204492,1204667-1204795,120...    28   9.8  
07_03_1020 + 23344657-23346969                                         28   9.8  
06_02_0244 - 13445023-13445400,13445495-13446823                       28   9.8  
06_01_1079 + 8832779-8833960                                           28   9.8  
05_03_0577 + 15671570-15672432,15672571-15672785,15672825-156729...    28   9.8  
02_05_0669 - 30755406-30756081,30756869-30756933,30757040-307572...    28   9.8  
01_01_1154 - 9178427-9178738,9179819-9180874                           28   9.8  
01_01_1152 + 9170628-9171899                                           28   9.8  

>01_01_0924 + 7301611-7301737,7301890-7302518
          Length = 251

 Score = 31.9 bits (69), Expect = 0.60
 Identities = 32/117 (27%), Positives = 53/117 (45%), Gaps = 5/117 (4%)
 Frame = -1

Query: 344 REELWASSPHREVHIKFLFTFLKGEATASEKVIRHASSHSSGRWGCFLSHSLIAAKSCAL 165
           R E W     R V  + LFTFL      +  +    ++  +G      + ++  A   A+
Sbjct: 9   RGEAWEPGCLRAVAGELLFTFLFVFIGVASTITAGKAAGGAGEAAAVTAAAMAQALVVAV 68

Query: 164 VLTSSFNSSRIFFHSSPEG*IRVAVDA-ISLLQ---YVTIQF-GTSCFVILFKCLTG 9
           + T+ F+ S    H +P   + +AV   I+L +   YV  Q  G+S   +L +CLTG
Sbjct: 69  LATAGFHVSG--GHLNPAVTLSLAVGGHITLFRSALYVAAQLAGSSLACLLLRCLTG 123


>02_03_0205 -
           16411707-16412759,16413077-16413256,16413960-16414498,
           16414798-16414825
          Length = 599

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 13/30 (43%), Positives = 19/30 (63%)
 Frame = +1

Query: 175 DLAAIKEWLRKQPHLPDEWEDACLMTFSEA 264
           D+ +I+EW   QPHLP+E     ++T  EA
Sbjct: 129 DVLSIEEWSLIQPHLPNETNTKIIVTTREA 158


>11_04_0383 - 17004520-17005150,17005205-17005327,17005641-17007142
          Length = 751

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 17/58 (29%), Positives = 26/58 (44%), Gaps = 1/58 (1%)
 Frame = -2

Query: 262 PRRKSSGTRLPTHLVDGVAFSA-TP*LQLSPVPWC*HPHSIPRGFSSTVPRKAESGSP 92
           P   ++   LP H+ + VA        ++S V WC   + +  GFS  V   A +G P
Sbjct: 559 PLAAATEVALPLHVANEVASPLQAAAAKVSDVHWCRRSNEVKHGFSQLVAGSATAGGP 616


>10_08_0235 - 16076133-16076411,16076457-16076972
          Length = 264

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 2/65 (3%)
 Frame = -1

Query: 329 ASSPHREVHIKFLF--TFLKGEATASEKVIRHASSHSSGRWGCFLSHSLIAAKSCALVLT 156
           A SPH  VH+      ++L+G   A   V+RHAS   S  +      S  A +     + 
Sbjct: 2   ACSPHAAVHVAMTLDASYLRGTIAAVLSVLRHASCPGSVHFHFLAVSSEAAVRELRDTVR 61

Query: 155 SSFNS 141
           +SF S
Sbjct: 62  ASFPS 66


>02_03_0214 + 16504237-16504251,16504447-16505055
          Length = 207

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = +1

Query: 175 DLAAIKEWLRKQPHLPDEWEDACLMTFSEA 264
           D+++I+EW   +PHLP E     ++T  EA
Sbjct: 128 DVSSIEEWSLIKPHLPSETNTKIIVTTREA 157


>05_01_0263 + 2020328-2020543,2020715-2021039,2021612-2022063
          Length = 330

 Score = 29.5 bits (63), Expect = 3.2
 Identities = 14/51 (27%), Positives = 26/51 (50%)
 Frame = -1

Query: 359 GYVSVREELWASSPHREVHIKFLFTFLKGEATASEKVIRHASSHSSGRWGC 207
           G+VS  +E+ ++ PH E   K L      +   +E+++  + +HS G   C
Sbjct: 151 GFVSKEDEVLSNVPHPEFGAKDLLKNFTAKGFTAEEMVTLSGAHSIGTSHC 201


>04_01_0369 + 4840371-4841294,4841921-4842559
          Length = 520

 Score = 29.1 bits (62), Expect = 4.3
 Identities = 10/41 (24%), Positives = 24/41 (58%)
 Frame = +1

Query: 97  TLIQPSGELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHL 219
           T++ P+G+ W+K+R+ L  ++ + A +   +   + +  HL
Sbjct: 116 TIMSPAGDQWRKMRQVLTSEILSPAMERRMLGRRVEEADHL 156


>10_02_0096 -
           5248369-5248479,5248562-5248604,5249093-5249178,
           5250089-5250153,5252539-5252747,5253077-5253188,
           5253271-5253322,5254593-5254685,5254997-5255146,
           5255223-5255327,5255858-5255891,5256145-5256281,
           5257691-5257819,5257899-5257977,5258081-5258156,
           5258981-5259070,5259181-5259259,5259397-5259431,
           5260722-5260811,5260913-5261027
          Length = 629

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 4/53 (7%)
 Frame = +3

Query: 558 VYVLDASILMPSHLRQDFTSSAEEI-LSFVYRKLIQ*NWKE-IHV--YQRISP 704
           V VL+A+ + P+H +QDF  +   I L    R++I   WKE  H+  YQ + P
Sbjct: 421 VGVLEANFIEPAHDKQDFERTPLFIRLEAKLRQIILDYWKEKCHLIGYQPVDP 473


>11_04_0313 + 16270807-16272271,16272713-16274140,16274289-16274788
          Length = 1130

 Score = 27.9 bits (59), Expect = 9.8
 Identities = 18/63 (28%), Positives = 29/63 (46%)
 Frame = +1

Query: 157  VNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVASPLRNVKRNLICTSR*GLLAQS 336
            V  R +D+  ++EW  +QP  P   E         AV  PL + + N +      L++ +
Sbjct: 837  VKLRIEDMTVLEEWTEQQPCFPCLEELTVRNCPKLAVLPPLHHARVNRMHIEGLPLISFN 896

Query: 337  SSR 345
            SSR
Sbjct: 897  SSR 899


>11_01_0145 +
           1204021-1204296,1204430-1204492,1204667-1204795,
           1205778-1205834,1205915-1206213,1206539-1206630,
           1206747-1206961,1207142-1207325,1207447-1207541,
           1208572-1208628,1209372-1209426,1209955-1210079
          Length = 548

 Score = 27.9 bits (59), Expect = 9.8
 Identities = 13/44 (29%), Positives = 26/44 (59%)
 Frame = +1

Query: 43  LVPNWIVTYCKSEMASTATLIQPSGELWKKIREELNEDVNTRAQ 174
           +VPNW++     ++ +TA LI    E   +I E + + V+T+++
Sbjct: 142 VVPNWLMKKTPLKLGATAGLILIGDEKANQILEAVRDVVHTKSK 185


>07_03_1020 + 23344657-23346969
          Length = 770

 Score = 27.9 bits (59), Expect = 9.8
 Identities = 14/35 (40%), Positives = 15/35 (42%)
 Frame = -1

Query: 311 EVHIKFLFTFLKGEATASEKVIRHASSHSSGRWGC 207
           EVH   LF F +G A       R A     G WGC
Sbjct: 238 EVHGAGLFMFARGTARGVAPKARIAMYKCGGNWGC 272


>06_02_0244 - 13445023-13445400,13445495-13446823
          Length = 568

 Score = 27.9 bits (59), Expect = 9.8
 Identities = 19/58 (32%), Positives = 29/58 (50%)
 Frame = +3

Query: 297 LDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGRRVTIARALDKNLD 470
           L  Y   R  C E   NRD    E+ D++  A+G  LPG +      T++  +D++LD
Sbjct: 511 LTPYDIGRILCRET-VNRD---SEIEDIVQEAEGHVLPGSSEVIFLETVSEIIDRHLD 564


>06_01_1079 + 8832779-8833960
          Length = 393

 Score = 27.9 bits (59), Expect = 9.8
 Identities = 15/59 (25%), Positives = 26/59 (44%), Gaps = 2/59 (3%)
 Frame = +1

Query: 28  RITKQLVPNWIVTYCKSEMASTATLIQPSGELWKKIREELNEDVNTRA--QDLAAIKEW 198
           R T  L P+W  ++ K E  ++   I P  E W  I  + + +    A   +L ++  W
Sbjct: 201 RFTCSLPPSWAKSHAKMEEFNSTPYISPYSERWAAIGTDADAEKRAVAVVHELLSLTLW 259


>05_03_0577 + 15671570-15672432,15672571-15672785,15672825-15672954,
            15672990-15673794,15674505-15674715,15674829-15675436
          Length = 943

 Score = 27.9 bits (59), Expect = 9.8
 Identities = 16/42 (38%), Positives = 20/42 (47%)
 Frame = +1

Query: 187  IKEWLRKQPHLPDEWEDACLMTFSEAVASPLRNVKRNLICTS 312
            I E    Q H+    ED  L+TFS A     R   R +ICT+
Sbjct: 899  IDETYLVQGHILKHGEDGSLITFSPAPQMKSRCQMRGIICTT 940


>02_05_0669 -
           30755406-30756081,30756869-30756933,30757040-30757209,
           30757313-30757496,30758536-30758619,30758740-30758938,
           30760200-30760441,30761811-30762053
          Length = 620

 Score = 27.9 bits (59), Expect = 9.8
 Identities = 14/37 (37%), Positives = 20/37 (54%)
 Frame = -1

Query: 308 VHIKFLFTFLKGEATASEKVIRHASSHSSGRWGCFLS 198
           +H++ L++ L G A    K  R A+   SGR   FLS
Sbjct: 487 LHLRLLYSQLPGYAVVQSKWARGAARPPSGRSSSFLS 523


>01_01_1154 - 9178427-9178738,9179819-9180874
          Length = 455

 Score = 27.9 bits (59), Expect = 9.8
 Identities = 13/34 (38%), Positives = 23/34 (67%)
 Frame = -1

Query: 269 ATASEKVIRHASSHSSGRWGCFLSHSLIAAKSCA 168
           A+A  KV+RH+ ++ +G+ G F S SL++  + A
Sbjct: 274 ASAGGKVVRHSDAYDAGKRGGFFS-SLLSGDTAA 306


>01_01_1152 + 9170628-9171899
          Length = 423

 Score = 27.9 bits (59), Expect = 9.8
 Identities = 23/96 (23%), Positives = 40/96 (41%)
 Frame = -2

Query: 385 FSRSISSGLVTSLFAKNSGQAALIVKYISSFFLHFSREKLQPRRKSSGTRLPTHLVDGVA 206
           F    + GL+  +   NS  ++ +V   ++  +HF      P   S+    P HL+DG A
Sbjct: 166 FVSDATEGLIRDVLPPNSVDSSTVVVLANA--VHFKGTWSLPFHPSATFHAPFHLLDGGA 223

Query: 205 FSATP*LQLSPVPWC*HPHSIPRGFSSTVPRKAESG 98
             A      + +P+  H  + P   +  +P K   G
Sbjct: 224 VRAP--FMTTEIPFERHVAAFPGFTALKLPYKNVGG 257


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,037,559
Number of Sequences: 37544
Number of extensions: 512476
Number of successful extensions: 1534
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 1480
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1534
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2150667972
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).