SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30038
         (661 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_05_0926 + 28871800-28871859,28871943-28872336,28872586-288731...   184   6e-47
11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930,306...   182   2e-46
05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-32...   182   2e-46
01_07_0285 - 42476767-42476832,42476990-42477603,42477821-424782...   182   2e-46
12_02_1282 + 27528159-27529148,27529549-27529614                      182   3e-46
01_06_1455 + 37504175-37504231,37504357-37504750,37504865-375054...   180   7e-46
05_04_0450 - 21356877-21356942,21357482-21358095,21358173-213585...   180   9e-46
10_08_0597 + 19089616-19089675,19089789-19090182,19090451-190910...   180   1e-45
12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847,323...   179   2e-45
03_06_0585 - 34912159-34912224,34912634-34913247,34913350-349137...   174   4e-44
08_02_0441 - 17196352-17196536,17196780-17196906,17198018-171981...   111   6e-25
02_04_0473 + 23197294-23197340,23197443-23197680,23197792-231980...   100   2e-21
08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328,160...    92   4e-19
08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698,207...    88   7e-18
04_03_0738 + 19169764-19169897,19169987-19170116,19170614-191706...    52   5e-07
01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744,931...    45   5e-05
03_06_0192 + 32230953-32231030,32231130-32231485,32232250-322324...    45   6e-05
01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104,238...    45   6e-05
07_03_0401 + 17724103-17724463,17724554-17724683,17725068-177250...    43   2e-04
07_03_0143 - 14315097-14315130,14315594-14315662,14316152-143162...    40   0.002
04_04_1515 + 34117383-34117732,34117833-34117918,34118227-341182...    36   0.022
06_03_0021 + 15520342-15520443,15522217-15522867,15522980-155231...    31   1.1  
05_01_0041 + 281427-281549,281671-281730,281822-281868,282013-28...    30   1.4  
08_01_1006 - 10191817-10191822,10192449-10192745,10192826-101929...    29   2.5  
04_04_0110 + 22840636-22840720,22840958-22841310                       29   2.5  
03_06_0598 + 34977063-34977220,34977957-34978101,34978362-349784...    29   2.5  
04_04_0065 + 22456225-22456744,22456813-22457768                       29   4.3  
03_01_0470 + 3619417-3619572,3619681-3619759,3620017-3620258,362...    29   4.3  
01_07_0267 + 42410174-42410252,42410679-42411097                       29   4.3  
12_02_0744 - 22704637-22705341                                         28   5.7  
06_01_0728 - 5356400-5356676,5356888-5357090,5357181-5357474,535...    28   5.7  
09_04_0537 + 18410201-18410207,18410301-18410586,18410674-184107...    28   7.6  
09_01_0066 - 978018-978500,978588-979034,979113-979412,979521-97...    28   7.6  
07_03_0263 - 15951011-15951818,15952009-15952526,15952949-159531...    28   7.6  
06_03_1205 - 28406183-28406218,28406462-28406548,28406769-284068...    28   7.6  
06_01_0121 - 932334-933074,933189-933272,934602-935006                 28   7.6  
05_03_0458 + 14280953-14281866,14281964-14282912                       28   7.6  
04_04_0962 + 29728983-29729034,29729622-29731369,29731656-297317...    28   7.6  
02_05_0211 - 26800089-26800439,26800458-26800649,26800721-268007...    28   7.6  

>03_05_0926 +
           28871800-28871859,28871943-28872336,28872586-28873199,
           28873281-28873346
          Length = 377

 Score =  184 bits (448), Expect = 6e-47
 Identities = 83/85 (97%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNTPAMYVAIQAVLSLYASGRTTGI 153



 Score =  121 bits (292), Expect = 4e-28
 Identities = 56/68 (82%), Positives = 60/68 (88%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 243
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 244 GILTSNTP 267
           GILT   P
Sbjct: 65  GILTLKYP 72



 Score = 99.5 bits (237), Expect = 2e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 154 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 199


>11_01_0403 +
           3059650-3059709,3059807-3060200,3060275-3060930,
           3060979-3061044
          Length = 391

 Score =  182 bits (443), Expect = 2e-46
 Identities = 82/85 (96%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  121 bits (292), Expect = 4e-28
 Identities = 56/68 (82%), Positives = 60/68 (88%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 243
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 244 GILTSNTP 267
           GILT   P
Sbjct: 65  GILTLKYP 72



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 45/46 (97%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERG
Sbjct: 154 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERG 199


>05_01_0047 -
           323097-323162,323287-323900,324233-324626,324718-324777
          Length = 377

 Score =  182 bits (443), Expect = 2e-46
 Identities = 82/85 (96%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  121 bits (292), Expect = 4e-28
 Identities = 56/68 (82%), Positives = 60/68 (88%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 243
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 244 GILTSNTP 267
           GILT   P
Sbjct: 65  GILTLKYP 72



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 45/46 (97%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERG
Sbjct: 154 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERG 199


>01_07_0285 -
           42476767-42476832,42476990-42477603,42477821-42478214,
           42478301-42478360
          Length = 377

 Score =  182 bits (443), Expect = 2e-46
 Identities = 82/85 (96%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  121 bits (292), Expect = 4e-28
 Identities = 56/68 (82%), Positives = 60/68 (88%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 243
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 244 GILTSNTP 267
           GILT   P
Sbjct: 65  GILTLKYP 72



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 45/46 (97%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERG
Sbjct: 154 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERG 199


>12_02_1282 + 27528159-27529148,27529549-27529614
          Length = 351

 Score =  182 bits (442), Expect = 3e-46
 Identities = 82/85 (96%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNAPAMYVAIQAVLSLYASGRTTGI 153



 Score =  120 bits (289), Expect = 1e-27
 Identities = 55/68 (80%), Positives = 60/68 (88%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 243
           +++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   DDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 244 GILTSNTP 267
           GILT   P
Sbjct: 65  GILTLKYP 72



 Score = 99.5 bits (237), Expect = 2e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 154 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 199


>01_06_1455 +
           37504175-37504231,37504357-37504750,37504865-37505478,
           37506021-37506086
          Length = 376

 Score =  180 bits (439), Expect = 7e-46
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAP+NPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNCPAMYVAIQAVLSLYASGRTTGI 152



 Score =  123 bits (297), Expect = 1e-28
 Identities = 56/71 (78%), Positives = 62/71 (87%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           M +E++  +V DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQ
Sbjct: 1   MAEEDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 92.7 bits (220), Expect = 2e-19
 Identities = 43/46 (93%), Positives = 44/46 (95%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEG+ LPHAILRLDLAGRDLTD LMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGFTLPHAILRLDLAGRDLTDNLMKILTERG 198


>05_04_0450 -
           21356877-21356942,21357482-21358095,21358173-21358566,
           21358648-21358704
          Length = 376

 Score =  180 bits (438), Expect = 9e-46
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIV NWDDMEKIWHHTFYNELRVAPE+HPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEDHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNCPAMYVAIQAVLSLYASGRTTGI 152



 Score =  124 bits (298), Expect = 8e-29
 Identities = 56/71 (78%), Positives = 62/71 (87%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           M DE++  +V DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQ
Sbjct: 1   MADEDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           +KRGILT   P
Sbjct: 61  AKRGILTLKYP 71



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/46 (95%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGY LPHAILRLDLAGRDLTD+LMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYTLPHAILRLDLAGRDLTDHLMKILTERG 198


>10_08_0597 +
           19089616-19089675,19089789-19090182,19090451-19091064,
           19091160-19091225
          Length = 377

 Score =  180 bits (437), Expect = 1e-45
 Identities = 80/85 (94%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F+ PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FSVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  121 bits (292), Expect = 4e-28
 Identities = 56/68 (82%), Positives = 60/68 (88%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 243
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 244 GILTSNTP 267
           GILT   P
Sbjct: 65  GILTLKYP 72



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 45/46 (97%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERG
Sbjct: 154 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERG 199


>12_01_0409 -
           3230853-3230918,3231372-3231994,3232454-3232847,
           3233000-3233059
          Length = 380

 Score =  179 bits (435), Expect = 2e-45
 Identities = 80/85 (94%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFE+
Sbjct: 69  LKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPALLTEAPLNPKANREKMTQIMFES 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  121 bits (292), Expect = 4e-28
 Identities = 56/68 (82%), Positives = 60/68 (88%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 243
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 244 GILTSNTP 267
           GILT   P
Sbjct: 65  GILTLKYP 72



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 45/46 (97%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERG
Sbjct: 154 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERG 199


>03_06_0585 -
           34912159-34912224,34912634-34913247,34913350-34913734,
           34913824-34913883
          Length = 374

 Score =  174 bits (424), Expect = 4e-44
 Identities = 78/81 (96%), Positives = 79/81 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGR 497
           FN PAMYVAIQAVLSLYASGR
Sbjct: 129 FNAPAMYVAIQAVLSLYASGR 149



 Score =  121 bits (292), Expect = 4e-28
 Identities = 56/68 (82%), Positives = 60/68 (88%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 243
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 244 GILTSNTP 267
           GILT   P
Sbjct: 65  GILTLKYP 72



 Score = 96.3 bits (229), Expect = 2e-20
 Identities = 45/48 (93%), Positives = 46/48 (95%)
 Frame = +2

Query: 503 RYVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           R VLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERG
Sbjct: 149 RIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDCLMKILTERG 196


>08_02_0441 -
           17196352-17196536,17196780-17196906,17198018-17198101,
           17198282-17198348,17198575-17198633,17199211-17199336,
           17199406-17199474,17199545-17199653,17199692-17199760,
           17199876-17199979,17200518-17200567,17200696-17200774,
           17200867-17200938,17201083-17201217,17201311-17201421,
           17202088-17202129
          Length = 495

 Score =  111 bits (266), Expect = 6e-25
 Identities = 47/86 (54%), Positives = 62/86 (72%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 431
           D+ YP+ +GIV +WDDM  IW H FY+EL+V P E  +LLT+ PLNP  NREKM + MFE
Sbjct: 67  DVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDPSECKILLTDPPLNPVKNREKMIETMFE 126

Query: 432 TFNTPAMYVAIQAVLSLYASGRTTGM 509
            +N   +++ +QAVLSLYA G  TG+
Sbjct: 127 KYNFAGVFIQVQAVLSLYAQGLLTGL 152



 Score = 60.9 bits (141), Expect = 9e-10
 Identities = 23/46 (50%), Positives = 36/46 (78%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+H VP+ +G++ PH   R+++AGR +T YL+ +L+ RG
Sbjct: 153 VIDSGDGVTHVVPVVDGFSYPHITKRMNVAGRHITSYLVDLLSRRG 198



 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 18/31 (58%), Positives = 24/31 (77%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 171
           +V DNG+G  K GFAG++ P +VFP +VGRP
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRP 37


>02_04_0473 +
           23197294-23197340,23197443-23197680,23197792-23198016,
           23198616-23198762,23198827-23198961,23199415-23199507,
           23199925-23200044,23200303-23200413,23200486-23200611,
           23200731-23200829,23201024-23201104
          Length = 473

 Score = 99.5 bits (237), Expect = 2e-21
 Identities = 46/87 (52%), Positives = 57/87 (65%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 431
           +L YPI +G V NWD ME+ W    +N LR  PE+H  LLTE+PL P   RE   +IMFE
Sbjct: 86  NLSYPIHNGQVENWDTMERFWQQCIFNYLRCDPEDHYFLLTESPLTPPETREYTGEIMFE 145

Query: 432 TFNTPAMYVAIQAVLSLYASGRTTGMC 512
           TFN P +Y+A Q VL+L A+G TT  C
Sbjct: 146 TFNVPGLYIACQPVLAL-AAGYTTTKC 171



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 15/42 (35%), Positives = 29/42 (69%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKIL 634
           V+D GDG +H VP+ +GY +  +I  + + G+D+T ++ ++L
Sbjct: 177 VVDVGDGATHIVPVADGYVIGSSIRSIPITGKDVTQFIQQLL 218



 Score = 34.7 bits (76), Expect = 0.066
 Identities = 14/29 (48%), Positives = 21/29 (72%)
 Frame = +1

Query: 76  ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 162
           A+V+DNG+G  K GFAG+  P  + P++V
Sbjct: 8   AVVIDNGTGYTKMGFAGNVEPCFITPTVV 36


>08_01_0194 -
           1603702-1603782,1603970-1604062,1604203-1604328,
           1604403-1604513,1604989-1605108,1605665-1605757,
           1606024-1606157,1606503-1606530,1606821-1607075,
           1607167-1607401,1608147-1608193
          Length = 440

 Score = 91.9 bits (218), Expect = 4e-19
 Identities = 39/77 (50%), Positives = 54/77 (70%)
 Frame = +3

Query: 258 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 437
           K+PI HG V +WD ME+ W    +N LR  PEEH  LLT++P++   +RE   +IMFETF
Sbjct: 87  KHPINHGQVDDWDTMERFWQQCIFNYLRCNPEEHYFLLTDSPVSTPESRECAGEIMFETF 146

Query: 438 NTPAMYVAIQAVLSLYA 488
           N P +Y+++Q+VLSL A
Sbjct: 147 NVPGLYISVQSVLSLSA 163



 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 20/55 (36%), Positives = 31/55 (56%)
 Frame = +2

Query: 497 YHRYVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGTRSLP 661
           Y   V+D GDG  H VP+  GY +  +I     +G D+T +++++L ERG    P
Sbjct: 187 YTGVVVDIGDGAPHVVPVVNGYVIGSSIKSFPFSGSDVTQFVLQLLQERGELIAP 241



 Score = 34.3 bits (75), Expect = 0.087
 Identities = 13/29 (44%), Positives = 20/29 (68%)
 Frame = +1

Query: 76  ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 162
           A+V+DNG+G  K GF+G+  P    P++V
Sbjct: 8   AVVIDNGTGYSKLGFSGNSEPCFTIPTVV 36


>08_01_0254 +
           2078380-2078392,2078487-2078578,2079579-2079698,
           2079924-2080097,2080184-2080257,2080847-2080927,
           2081306-2081366,2081437-2081486,2082278-2082332,
           2082599-2082676,2082757-2082810,2083703-2083756,
           2083846-2083906,2084229-2084280,2085118-2085184,
           2085393-2085452,2085546-2085608,2085752-2085814,
           2086337-2086401,2086620-2086688,2086742-2086847
          Length = 503

 Score = 87.8 bits (208), Expect = 7e-18
 Identities = 36/82 (43%), Positives = 54/82 (65%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           P++ G VT+WD ++ IW+H F   L + PEEHP+L+ E   N    REK  ++MFE +  
Sbjct: 137 PMKDGTVTDWDIVDNIWNHAFRQRLLINPEEHPMLIAEPSTNTGQQREKAAELMFEKYKV 196

Query: 444 PAMYVAIQAVLSLYASGRTTGM 509
           PA+++A  AVL+ +ASGR T +
Sbjct: 197 PALFLAKNAVLTSFASGRATSL 218



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 21/32 (65%), Positives = 28/32 (87%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 159
           +EV+A+V+D GS  CKAG+AGDD P+AVFPS+
Sbjct: 5   DEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSL 36



 Score = 36.7 bits (81), Expect = 0.016
 Identities = 16/46 (34%), Positives = 26/46 (56%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSG G +    +++GY L  ++    + G  LTD +MK L  +G
Sbjct: 219 VVDSGGGSTVVAAVHDGYVLQKSVATSPIGGEFLTDCMMKSLESKG 264


>04_03_0738 +
           19169764-19169897,19169987-19170116,19170614-19170687,
           19171208-19171288,19172054-19172087
          Length = 150

 Score = 51.6 bits (118), Expect = 5e-07
 Identities = 20/49 (40%), Positives = 29/49 (59%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 410
           P++ G   +WD ++ IW+H F   L + PEEHP+L+ E   N    REK
Sbjct: 92  PMKDGTFIDWDIVDNIWNHAFRQRLLINPEEHPMLIVEPSTNTGQQREK 140


>01_01_1170 -
           9318332-9318461,9318551-9318613,9318694-9318744,
           9318837-9318921,9319005-9319068,9319139-9319340,
           9319808-9320502
          Length = 429

 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 1/82 (1%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L+ PI+ G + N +   ++W     N L+V P    +LL E   NP A +    +++FE 
Sbjct: 62  LRRPIDRGYLINQEVQREVWERVIRNLLQVDPNNSSLLLVEPQFNPPALQHATDELVFEE 121

Query: 435 FNTPAMYVA-IQAVLSLYASGR 497
               ++ VA   +++ LY + R
Sbjct: 122 LGFKSLCVADAPSLVHLYEASR 143



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 16/45 (35%), Positives = 30/45 (66%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+D G   +H  P+ + + L +A+ R+DL G+ LT+YL ++++ R
Sbjct: 155 VVDCGFSFTHASPVLQNFTLNYAVRRMDLGGKALTNYLKELISYR 199



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 16/31 (51%), Positives = 22/31 (70%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 171
           +V+DNG G+ KAGF GD  P AV P+ + +P
Sbjct: 8   VVLDNGGGLLKAGFGGDMNPTAVVPNCMAKP 38


>03_06_0192 +
           32230953-32231030,32231130-32231485,32232250-32232425,
           32233857-32234038,32234260-32234443,32235192-32235259,
           32235343-32235495
          Length = 398

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 21/38 (55%), Positives = 27/38 (71%)
 Frame = +3

Query: 393 KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTG 506
           +A RE++ Q+MFE FN    Y + QAVLSLYA GR +G
Sbjct: 156 QALREQLAQLMFEKFNVSGFYDSEQAVLSLYAVGRISG 193



 Score = 27.9 bits (59), Expect = 7.6
 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%)
 Frame = +1

Query: 76  ALVVDNGSGMCKAGFA-GDDAPRAVFPS 156
           A+VVD GS + KAG A  D +P  V PS
Sbjct: 3   AVVVDAGSKLLKAGIALPDQSPSLVMPS 30


>01_01_0292 -
           2387653-2387711,2388061-2388684,2388814-2389104,
           2389338-2389390,2390496-2390968,2391090-2391432,
           2391793-2391911,2392081-2392512,2392657-2392747,
           2392833-2392942,2393681-2393875,2394581-2394622,
           2395144-2395268,2395856-2395926,2396047-2396147
          Length = 1042

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 19/66 (28%), Positives = 37/66 (56%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           ++ P +  +V  ++ ME I    F      +   HP+L+TE   NP  +R +M++++FET
Sbjct: 82  IRSPFDDDVVYQFEYMEYILDFGFDRLGATSEVGHPILMTECECNPSFSRARMSELLFET 141

Query: 435 FNTPAM 452
           +  P++
Sbjct: 142 YGVPSI 147



 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 20/49 (40%), Positives = 30/49 (61%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD 225
           +V+DNG+   + G+AG+  PR  F +IV RPRH+      G+  + VGD
Sbjct: 22  IVIDNGASTFRIGWAGEAEPRVAFRNIVQRPRHR----SSGETVTVVGD 66


>07_03_0401 +
           17724103-17724463,17724554-17724683,17725068-17725083,
           17725130-17725203,17725693-17725761,17726224-17726257
          Length = 227

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 19/49 (38%), Positives = 27/49 (55%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 410
           P++ G   +WD ++ IW+H F       PEEHP+L+ E   N    REK
Sbjct: 173 PMKDGTFIDWDIVDNIWNHAF----SFYPEEHPMLIVEPSTNTGQQREK 217


>07_03_0143 -
           14315097-14315130,14315594-14315662,14316152-14316225,
           14316316-14316331,14316716-14316845,14316936-14316999
          Length = 128

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 410
           P++ G   +WD ++ IW+H F        EEHP+L+ E   N    REK
Sbjct: 74  PMKDGTFIDWDIVDNIWNHAF----SFYAEEHPMLIVEPSTNTGQQREK 118


>04_04_1515 +
           34117383-34117732,34117833-34117918,34118227-34118297,
           34118457-34118524,34118692-34118753,34119010-34119107,
           34119545-34119626,34119935-34120077,34120233-34120381,
           34120461-34120594,34120714-34120832,34120926-34121014,
           34121398-34121515
          Length = 522

 Score = 36.3 bits (80), Expect = 0.022
 Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 10/73 (13%)
 Frame = +3

Query: 321 TFYNELRVAPEEHPVLL---------TE-APLNPKANREKMTQIMFETFNTPAMYVAIQA 470
           T Y  ++V P   P+++         TE A  + K  R+ +  ++F+  N PA+    QA
Sbjct: 188 TIYTRMQVKPSTQPIIVVLPLCHSDDTESARASRKQYRDTLYSVLFD-MNVPAVCSVDQA 246

Query: 471 VLSLYASGRTTGM 509
           VL+LYA+ RT+G+
Sbjct: 247 VLALYAAKRTSGI 259


>06_03_0021 +
           15520342-15520443,15522217-15522867,15522980-15523186,
           15523698-15523913,15523992-15524214,15525052-15525299,
           15525385-15525563,15525803-15526056,15526237-15526388
          Length = 743

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 16/65 (24%), Positives = 32/65 (49%)
 Frame = -3

Query: 362 GMFLGGDTELIVEGMMPNLLHVIPVSDDSVFDGVFEVRIPLLLCASSPTYESFCPMPTIT 183
           G F+ G  ++    +  +++  +   DD+ FD + + +IPL+L   +    +F    TI 
Sbjct: 247 GGFIQGVLDITTTEVADHIVGGVMACDDTRFDAIIDNKIPLVLSVGALDMVNFGARDTIP 306

Query: 182 P*WRG 168
           P + G
Sbjct: 307 PDFTG 311


>05_01_0041 +
           281427-281549,281671-281730,281822-281868,282013-282089,
           285368-285440,286193-286281,286665-286711,286805-286885,
           287011-287179,287381-287600,287679-287744,288194-288310,
           288591-288628,288935-289032
          Length = 434

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 23/63 (36%), Positives = 27/63 (42%), Gaps = 3/63 (4%)
 Frame = +1

Query: 442 RPPCTSP---SKPCSRCTRPVVPPVCAGLRRRCLPHRTHLRGIRTPSRHPASGLGRSRPH 612
           R P  SP   S P  R   P   P    +RRR  P  + +R   TPSR P S + R  P 
Sbjct: 261 RKPAPSPRRRSPPSRRVESPRCRPDSPPIRRRTAP--SPIRHGGTPSRRPGSPIRRRSPS 318

Query: 613 RLP 621
             P
Sbjct: 319 PPP 321


>08_01_1006 -
           10191817-10191822,10192449-10192745,10192826-10192975,
           10194558-10195370
          Length = 421

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = -3

Query: 203 CPMPTITP*WRGLPTIEGNTARGASSPAK 117
           C MP   P +RG P++   T RG + PA+
Sbjct: 142 CDMPLAPPGFRGFPSLVSLTLRGVTLPAE 170


>04_04_0110 + 22840636-22840720,22840958-22841310
          Length = 145

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 1/42 (2%)
 Frame = +1

Query: 436 STRPPCTSPSKPCSRCTRPVVPPVCAGLRRRC-LPHRTHLRG 558
           S  P CT    PCS C R +V   CA     C + +R   RG
Sbjct: 96  SRLPDCTHACGPCSPCRRVMVSLRCAEAAESCPVAYRCMCRG 137


>03_06_0598 +
           34977063-34977220,34977957-34978101,34978362-34978481,
           34978640-34978774,34979138-34979213,34979398-34979450,
           34979594-34979695,34979848-34979964,34980170-34980228,
           34980810-34980984,34981628-34981762,34981855-34981953,
           34982143-34982251,34982981-34983093,34983206-34983265,
           34983821-34983835
          Length = 556

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 16/43 (37%), Positives = 24/43 (55%)
 Frame = -2

Query: 249 DTSFALCLVSYVRVFLSHADHHTLMAGPSDDRGEYGARSIISC 121
           +T F L LV+Y  +  ++A  H L+AG S +  E+G R    C
Sbjct: 147 ETPF-LSLVNYASLVTTNAARHRLVAGKSKNLLEFGLRRAQQC 188


>04_04_0065 + 22456225-22456744,22456813-22457768
          Length = 491

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 12/31 (38%), Positives = 15/31 (48%)
 Frame = +1

Query: 496 VPPVCAGLRRRCLPHRTHLRGIRTPSRHPAS 588
           VPP+C   R  CLPH + L      +  P S
Sbjct: 88  VPPLCRSTRETCLPHFSRLLADLNANASPES 118


>03_01_0470 +
           3619417-3619572,3619681-3619759,3620017-3620258,
           3620804-3621148,3623592-3624116
          Length = 448

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 12/40 (30%), Positives = 21/40 (52%)
 Frame = -3

Query: 176 WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSSH 57
           WR  P +  + ARG S P + AL   +P++     +++ H
Sbjct: 251 WRRTPWVGAHAARGGSRPLRRALQGLDPVTIAAIFSTAEH 290


>01_07_0267 + 42410174-42410252,42410679-42411097
          Length = 165

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 15/42 (35%), Positives = 23/42 (54%)
 Frame = -1

Query: 544 YGVGDTVAGVQHIPVVRPDAYSESTAWMATYMAGVLNVSNMI 419
           YG   +  GV H+ V+RP+   +S   +   MAGVL +  +I
Sbjct: 32  YGTARSGVGVAHMGVMRPELVMKSI--VPVVMAGVLGIYGLI 71


>12_02_0744 - 22704637-22705341
          Length = 234

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = +1

Query: 430 KHSTRPPCTSPSKPCSRCTRPVVPPVCAGLRR 525
           +H  RPP +SP+ P S  +R V PP  +G  R
Sbjct: 93  RHRRRPPRSSPA-PTSSSSRGVSPPPTSGRSR 123


>06_01_0728 -
           5356400-5356676,5356888-5357090,5357181-5357474,
           5357940-5358063,5358157-5359496
          Length = 745

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 20/70 (28%), Positives = 30/70 (42%), Gaps = 1/70 (1%)
 Frame = +1

Query: 427 SKHSTRPPCTSPSKPCSRCTRPVVPPVCAG-LRRRCLPHRTHLRGIRTPSRHPASGLGRS 603
           +K    P  T+ S P +  +RP +PP  A  LRRR    +   R +  P+  P+S    +
Sbjct: 52  AKPPQNPEKTAASSPHAPSSRPPLPPASAALLRRRSSLTKPKSRFVE-PAAPPSSAAAAA 110

Query: 604 RPHRLPHEDP 633
                 H  P
Sbjct: 111 ASSTSSHASP 120


>09_04_0537 +
           18410201-18410207,18410301-18410586,18410674-18410773,
           18410881-18411147,18411286-18411363,18411444-18411545,
           18411628-18411677,18411793-18411889,18412248-18412361,
           18412495-18412666,18412865-18413217,18413812-18413898,
           18413981-18414001
          Length = 577

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 3/71 (4%)
 Frame = +3

Query: 156 DRRKAPPSGCDGRHGTERLVRRRRGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNE 335
           D R+    G   R    R +R+R G  ++R  D +YP    I    D  E++    F + 
Sbjct: 20  DDRRRRGMGSSLRRKAIRALRKRGGRRRRRRVDFRYPAAMSIEDVRDAEEELAVAAFRDR 79

Query: 336 LRV---APEEH 359
           L V    P++H
Sbjct: 80  LAVHALLPDKH 90


>09_01_0066 -
           978018-978500,978588-979034,979113-979412,979521-979855,
           980325-980703
          Length = 647

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 22/58 (37%), Positives = 26/58 (44%), Gaps = 1/58 (1%)
 Frame = +1

Query: 442 RPPCTSPSKPCSRC-TRPVVPPVCAGLRRRCLPHRTHLRGIRTPSRHPASGLGRSRPH 612
           RPP  SP+ P  R  T+P  PP  A L R     R  LR      RH    L R++ H
Sbjct: 47  RPP-PSPTPPARRRPTKPASPPTGAALYRARRCRRKLLRCRARHRRHRDRCLHRAQRH 103


>07_03_0263 -
           15951011-15951818,15952009-15952526,15952949-15953197,
           15953270-15953857
          Length = 720

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 14/47 (29%), Positives = 20/47 (42%), Gaps = 1/47 (2%)
 Frame = -2

Query: 240 FALCLVSYVRVFLSHADHHTLMAGPSDDRGEYGARSIIS-CETGLAH 103
           F  C+ +++ V     DH  ++    DD G      IIS C   L H
Sbjct: 449 FKKCVDNFLHVLKQEEDHGPMVEEAKDDGGSTSEDEIISMCRNNLVH 495


>06_03_1205 -
           28406183-28406218,28406462-28406548,28406769-28406830,
           28407968-28408184,28408793-28408957,28409145-28409250,
           28409830-28410071,28410493-28410605,28410848-28411043,
           28411681-28411827,28412034-28412218,28412478-28412592,
           28413237-28413728
          Length = 720

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 20/63 (31%), Positives = 25/63 (39%), Gaps = 1/63 (1%)
 Frame = +1

Query: 463 SKPCSRCTRPVVPPVCAGLRRRCLPHRTHLRGIRTPSRHPASGLGRSRPHR-LPHEDPHR 639
           S P +   R   PP    LRRRC PH    + +   +R P     RS P     H D H 
Sbjct: 17  SPPSAHLLRLSRPPPFPHLRRRCAPHLPS-KPLNLAARSPLLLARRSLPFAPRAHGDHHH 75

Query: 640 ARY 648
             +
Sbjct: 76  GHH 78


>06_01_0121 - 932334-933074,933189-933272,934602-935006
          Length = 409

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 10/16 (62%), Positives = 11/16 (68%)
 Frame = -2

Query: 489 TRTARARLGWRRTWRA 442
           TR  R R+GWRR W A
Sbjct: 103 TRGGRGRVGWRRQWSA 118


>05_03_0458 + 14280953-14281866,14281964-14282912
          Length = 620

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 13/36 (36%), Positives = 17/36 (47%)
 Frame = +1

Query: 424 CSKHSTRPPCTSPSKPCSRCTRPVVPPVCAGLRRRC 531
           CS H T PP  SP+   S  + P VP   +    +C
Sbjct: 85  CSSHPTPPPPPSPTTSPSASSLPPVPTPRSASSSKC 120


>04_04_0962 + 29728983-29729034,29729622-29731369,29731656-29731742,
            29732035-29732199,29732437-29732526,29732863-29733027,
            29733124-29733418,29733550-29733764,29733879-29733947,
            29734107-29734184,29734466-29734529,29734658-29734897,
            29734985-29735124
          Length = 1135

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 14/39 (35%), Positives = 19/39 (48%)
 Frame = +1

Query: 250  LTSNTPSNTESSLTGMTWRRFGIIPSTMSSVSPPRNIPS 366
            L S  P+ TE S   M W  FG+I  +   V    ++PS
Sbjct: 910  LPSEAPTITEGSKPPMAWPEFGMISISNLEVRYAEHLPS 948


>02_05_0211 -
           26800089-26800439,26800458-26800649,26800721-26800792,
           26800941-26801126
          Length = 266

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 1/55 (1%)
 Frame = +1

Query: 427 SKHSTRPPCTSPSKPCSRCTRPVVPPVCAGLRRRC-LPHRTHLRGIRTPSRHPAS 588
           ++ + R    S   PC+ C RP +P         C +P RT ++ + +P+RH  S
Sbjct: 116 NERTARKRSASVENPCAACARP-LPSGHDYCSLFCKVPSRTRVKLLSSPARHSNS 169


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,518,563
Number of Sequences: 37544
Number of extensions: 547860
Number of successful extensions: 2213
Number of sequences better than 10.0: 39
Number of HSP's better than 10.0 without gapping: 2054
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2210
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1655832080
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).