SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30036
         (699 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_02_0043 + 5242496-5242554,5242673-5242778,5243586-5243723,524...   124   7e-29
12_02_0012 - 12309332-12310228,12311087-12311669,12311945-123120...   123   1e-28
02_02_0482 - 10819562-10819813,10820773-10820952,10822073-108221...   123   2e-28
07_03_0335 - 16903775-16904118,16904203-16904325,16904424-16905993     29   4.7  
06_03_0290 - 19193707-19193752,19193822-19194090                       29   4.7  
02_04_0307 - 21905897-21906490,21906581-21906722,21907116-219072...    29   4.7  
01_05_0462 - 22451250-22451525,22451788-22451958,22452182-22452457     28   6.2  
11_06_0666 + 26055471-26056290,26066462-26067192                       28   8.2  
03_05_0791 + 27736978-27737217,27737648-27739191,27739512-277397...    28   8.2  

>03_02_0043 +
           5242496-5242554,5242673-5242778,5243586-5243723,
           5243794-5243979,5244075-5244275,5244362-5244460
          Length = 262

 Score =  124 bits (299), Expect = 7e-29
 Identities = 58/104 (55%), Positives = 75/104 (72%)
 Frame = +1

Query: 256 VLCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCY 435
           VL NF GM  TTDKLR +VKKWQTLIEA++DVKTTDGY+LR+FCIGFT +     ++TCY
Sbjct: 96  VLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDGYMLRLFCIGFTKRRPNQVKRTCY 155

Query: 436 AQHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           AQ +Q+R IR+KM EI+    ++ D     +   P+ I K+IEK
Sbjct: 156 AQASQIRQIRRKMVEIMANQASSCDLKELVSKFIPEVIGKEIEK 199



 Score =  123 bits (296), Expect = 2e-28
 Identities = 60/84 (71%), Positives = 70/84 (83%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK VDPF +KDWYD+KAPS+F+ R +G TLV+RTQGTKIASEGLK RVFEVSLAD
Sbjct: 13  KKGSKKKTVDPFAKKDWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLAD 72

Query: 182 LQADTDAERSFRKFRLIAEYVQGR 253
           LQ D D  +++RK RL AE VQG+
Sbjct: 73  LQNDED--QAYRKIRLRAEDVQGK 94


>12_02_0012 -
           12309332-12310228,12311087-12311669,12311945-12312051,
           12313190-12313237,12315139-12315216,12315300-12315500,
           12315612-12315797,12315870-12316007,12318311-12318416,
           12318529-12318587
          Length = 800

 Score =  123 bits (297), Expect = 1e-28
 Identities = 61/84 (72%), Positives = 70/84 (83%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK VDPF +KDWYD+KAPS+F+ R VG TLV+RTQGTKIASEGLK RVFEVSLAD
Sbjct: 13  KKGSKKKTVDPFAKKDWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLAD 72

Query: 182 LQADTDAERSFRKFRLIAEYVQGR 253
           LQ D D  +++RK RL AE VQG+
Sbjct: 73  LQNDED--QAYRKIRLRAEDVQGK 94



 Score =  122 bits (293), Expect = 4e-28
 Identities = 57/104 (54%), Positives = 74/104 (71%)
 Frame = +1

Query: 256 VLCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCY 435
           VL NF GM  TTDKLR +VKKWQTLIEA++DVKTTD Y+LR+FCIGFT +     ++TCY
Sbjct: 96  VLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCY 155

Query: 436 AQHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           AQ +Q+R IR+KM EI+    ++ D     +   P+ I K+IEK
Sbjct: 156 AQASQIRQIRRKMVEIMVNQASSCDLKELVSKFIPEVIGKEIEK 199


>02_02_0482 -
           10819562-10819813,10820773-10820952,10822073-10822150,
           10823056-10823256,10823365-10823550,10823646-10823783,
           10824396-10824501,10824634-10824692
          Length = 399

 Score =  123 bits (296), Expect = 2e-28
 Identities = 60/84 (71%), Positives = 71/84 (84%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           +KG KKK VDPF++KDWYD+KAP++FS R +G TLV+RTQGTKIASEGLK RVFEVSLAD
Sbjct: 13  RKGSKKKTVDPFSKKDWYDIKAPTVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLAD 72

Query: 182 LQADTDAERSFRKFRLIAEYVQGR 253
           LQ D D  +++RK RL AE VQGR
Sbjct: 73  LQNDED--QAYRKVRLRAEDVQGR 94



 Score =  122 bits (293), Expect = 4e-28
 Identities = 63/122 (51%), Positives = 80/122 (65%)
 Frame = +1

Query: 256 VLCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCY 435
           VL NF GM  TTDKLR +VKKWQTLIEA++DVKTTD Y+LR+FCIGFT +     ++TCY
Sbjct: 96  VLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCY 155

Query: 436 AQHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEKGLPWHLTLCAMFGIRK 615
           AQ +Q+R IR+KM EI+    +  D     +   P+ I K+IEK       L  +F IRK
Sbjct: 156 AQASQIRQIRRKMVEIMANQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVF-IRK 214

Query: 616 *K 621
            K
Sbjct: 215 VK 216


>07_03_0335 - 16903775-16904118,16904203-16904325,16904424-16905993
          Length = 678

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 1/39 (2%)
 Frame = -1

Query: 696 PCLHRLRR-ESSQSTSRSPKTGPSSTLSLSDAKHRAEGK 583
           P LH      S+ S+SRS + G S+  S+ D     EGK
Sbjct: 140 PMLHTFHHLRSATSSSRSSQDGDSNDSSIEDGNENQEGK 178


>06_03_0290 - 19193707-19193752,19193822-19194090
          Length = 104

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 23/76 (30%), Positives = 31/76 (40%)
 Frame = +2

Query: 122 GTKIASEGLKGRVFEVSLADLQADTDAERSFRKFRLIAEYVQGRMCSATSTAWTSQPISS 301
           GT  AS GL G         +   + +  SF   R+ A    G      S A T  P  S
Sbjct: 30  GTPAASRGLPGWP---GFCGVGCGSSSSSSFAPPRMQARRAAG------SAARTRSPSQS 80

Query: 302 GGWLKNGRLSSKPTLM 349
            GW+  G  S+ P+L+
Sbjct: 81  NGWITGGSASAMPSLV 96


>02_04_0307 -
           21905897-21906490,21906581-21906722,21907116-21907247,
           21907303-21907433,21908028-21908185,21908299-21908396,
           21908511-21908631,21908748-21908965,21909230-21909429
          Length = 597

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 10/34 (29%), Positives = 20/34 (58%)
 Frame = +1

Query: 217 QIQINRRICARTYVLCNFHGMDLTTDKLRWMVKK 318
           ++ ++ R CA  + L   HG D+T+D +   V++
Sbjct: 188 ELMLDMRTCAMAFRLLRMHGYDITSDGMAQFVEQ 221


>01_05_0462 - 22451250-22451525,22451788-22451958,22452182-22452457
          Length = 240

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 31/101 (30%), Positives = 43/101 (42%), Gaps = 16/101 (15%)
 Frame = +2

Query: 443 TLRSEQSER-KCVKSLHATSLTLTQGGGEQVDFLTPLPRTSRRACHG------ILPSARC 601
           TL +E +ER K ++S     L +    GE V ++    RT  + CHG      +LP    
Sbjct: 121 TLTTEVAERLKAIRSTWREQL-IESANGETVQYV----RT--KICHGMICPLFVLPDGLS 173

Query: 602 LASESESVEEGPV---------FGDLEVDWELSRRRRWRQG 697
                 S E+  V         F D E DW+ + R RWR G
Sbjct: 174 YFHHGRSSEKDIVGTSILEVDDFSDAEEDWKDAGRSRWRVG 214


>11_06_0666 + 26055471-26056290,26066462-26067192
          Length = 516

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = +3

Query: 558 HREGPAMASYPLRDVWHPKVKVL 626
           H   P+ +S PLR  WH ++K L
Sbjct: 294 HLHDPSFSSSPLRASWHMRIKTL 316


>03_05_0791 +
           27736978-27737217,27737648-27739191,27739512-27739763,
           27739844-27739954,27740042-27740102,27740373-27740558
          Length = 797

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = -3

Query: 169 NFENSSLQSFRSNFRSLGTVDKRGADLPLAE 77
           +FENS LQSF     +L +  K+G   P  E
Sbjct: 216 SFENSELQSFTDKIENLSSSQKKGYFKPKRE 246


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,425,581
Number of Sequences: 37544
Number of extensions: 452162
Number of successful extensions: 1406
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1353
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1403
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1792053856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).