SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30027
         (765 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_03_1284 - 28988287-28988922,28989335-28989765,28989850-289899...   169   2e-42
02_01_0355 + 2558792-2558862,2558993-2559099,2559185-2559615,256...   164   6e-41
03_05_0052 - 20293197-20293310,20293938-20294024,20294133-202942...   160   1e-39
01_06_0020 + 25630728-25631023,25631308-25631548,25631629-256317...   159   3e-39
02_02_0099 + 6768115-6768285,6769950-6770034,6770501-6770628,677...   101   6e-22
04_04_0613 + 26617677-26617963,26618726-26618786,26619598-266198...    85   8e-17
02_05_0096 + 25785995-25786311,25786716-25786776,25787825-257880...    85   8e-17
10_08_0553 - 18720436-18720494,18721102-18721106,18721136-187212...    83   2e-16
07_03_1566 + 27766336-27766393,27766480-27766609,27766728-277667...    66   3e-11
07_03_1392 - 26238885-26239007,26239137-26239235,26239636-262397...    66   4e-11
12_02_1076 - 25862671-25863159,25863290-25863451,25863614-258638...    64   9e-11
11_06_0767 + 27121761-27123335,27123701-27123910,27124843-271249...    61   1e-09
07_02_0023 - 11918735-11918827,11919139-11919231,11919320-119194...    61   1e-09
02_01_0765 - 5694535-5694644,5695039-5696550,5697229-5697390,569...    61   1e-09
01_05_0296 + 20567259-20567386,20568895-20569123,20569205-205694...    61   1e-09
01_05_0295 + 20537147-20537291,20539111-20539283,20539365-205395...    61   1e-09
03_06_0531 + 34552206-34552598,34552665-34552735,34553363-345533...    60   3e-09
07_01_0322 - 2258067-2258519,2258620-2258781,2258896-2259159,225...    58   6e-09
03_05_0619 - 26180980-26181105,26181329-26181417,26181518-261816...    58   6e-09
12_02_0340 - 17725866-17725884,17726046-17726326,17726842-177269...    58   8e-09
03_05_0865 - 28365430-28367640                                         58   8e-09
01_01_0682 - 5244805-5244919,5246468-5246613,5246813-5246994,524...    56   3e-08
03_02_0758 + 10954268-10954841,10955988-10957145,10957176-109572...    55   7e-08
01_06_1758 - 39681942-39682030,39682115-39682345,39682643-396826...    55   7e-08
08_01_0353 - 3107628-3107774,3108177-3108213,3108248-3109164,310...    54   9e-08
08_01_0397 - 3509186-3510291,3510322-3512335                           54   1e-07
07_01_0725 - 5532803-5533324,5533631-5533657,5534285-5534398,553...    54   1e-07
03_06_0365 - 33399422-33399925,33400470-33400583,33400762-334009...    53   2e-07
11_06_0300 + 22095396-22096145,22096261-22096344,22097062-220973...    53   3e-07
08_02_0671 - 19890187-19890295,19891186-19891320,19891551-198919...    52   4e-07
01_01_0602 - 4484972-4485450,4485949-4485997,4486108-4486237,448...    52   4e-07
01_05_0292 + 20518668-20519090,20519213-20519281,20520204-205204...    52   5e-07
07_03_1500 + 27001842-27002058,27002144-27002283,27002458-270025...    50   2e-06
07_03_0601 - 19872780-19873099,19873148-19873151,19874196-198743...    50   2e-06
06_03_0337 + 19678152-19678484,19678616-19678801,19679232-196794...    50   3e-06
01_05_0722 + 24598426-24598649,24599113-24599219,24599319-245993...    49   4e-06
09_05_0008 + 20042390-20042845,20043323-20043457,20043539-200436...    49   5e-06
06_03_1255 + 28780181-28781172,28782065-28782932                       49   5e-06
01_01_0509 - 3713109-3713244,3713689-3713733,3713959-3714015,371...    49   5e-06
06_03_0287 - 19168685-19168735,19168847-19168884,19169517-191697...    48   6e-06
01_01_0447 - 3327727-3328144,3328438-3328688,3328820-3328909,332...    48   1e-05
04_04_0476 - 25508952-25509004,25509245-25509326,25509453-255096...    47   2e-05
01_05_0721 + 24594815-24594834,24595207-24595313,24595417-245954...    47   2e-05
02_05_1293 - 35520733-35520963,35521696-35521878,35522040-355222...    46   3e-05
03_01_0399 + 3097878-3098141,3098254-3098547,3098659-3098886,309...    45   8e-05
03_06_0344 - 33276366-33276548,33277044-33277169,33277254-332773...    44   2e-04
06_03_0674 + 23422004-23422552,23423295-23423369,23424360-234244...    40   0.003
05_01_0079 + 531617-531734,531987-532059,532152-532261,532400-53...    40   0.003
02_05_0064 - 25529630-25531440,25531663-25531673,25533113-255331...    39   0.005
01_07_0333 - 42813789-42814073,42814229-42814315,42815083-428151...    39   0.005
03_02_0189 - 6253659-6255380                                           38   0.009
12_01_0445 - 3513733-3513819,3514392-3514613,3514730-3514999,351...    29   4.1  
04_04_1535 + 34205426-34205593,34205697-34206869                       29   4.1  
04_03_0653 - 18429736-18431379                                         29   4.1  
11_01_0192 - 1523572-1526097                                           28   7.1  
03_05_0997 + 29565311-29565664,29566134-29566298,29566572-295666...    28   7.1  
01_07_0043 + 40699334-40700482                                         28   7.1  
11_06_0683 + 26259129-26259968                                         28   9.4  
07_03_1304 - 25629822-25629839,25630091-25631148,25631784-256349...    28   9.4  
06_03_0996 + 26731442-26732121,26732573-26732772,26732930-26733330     28   9.4  
05_06_0267 - 26784861-26784896,26785324-26785404,26785530-267857...    28   9.4  
04_01_0545 + 7046861-7047955,7048822-7049436,7052887-7054692           28   9.4  

>06_03_1284 -
           28988287-28988922,28989335-28989765,28989850-28989956,
           28990066-28990136
          Length = 414

 Score =  169 bits (412), Expect = 2e-42
 Identities = 99/207 (47%), Positives = 130/207 (62%), Gaps = 4/207 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATF   ILQQ+D ++ ECQAL+LAPTRELAQQI+KV+ ALGD+L  K HAC+GGT+V
Sbjct: 90  GKTATFCSGILQQLDYAVVECQALVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSV 149

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
           RED R L SGVHVVVGTPGRV+DM+      P   +++ +  L +    +SR        
Sbjct: 150 REDQRILASGVHVVVGTPGRVFDMLRRQSLRP---DYIKMFVLDEADEMLSRGFKDQIYD 206

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EIL---YAYLYRRKSLPWKVLNNF-TCIELEEW 528
             QL+       +    M  + L+   + +      L +R  L  + +  F   +E EEW
Sbjct: 207 IFQLLPSKIQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEW 266

Query: 529 KLETLCDLYDTLSIAQAVIFCNTRRKV 609
           KL+TLCDLY+TL+I Q+VIF NTRRKV
Sbjct: 267 KLDTLCDLYETLAITQSVIFVNTRRKV 293



 Score =  118 bits (284), Expect = 5e-27
 Identities = 54/85 (63%), Positives = 73/85 (85%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R++L  + IK+FVLDEADEMLSRGFKDQI+D+F++L + +QV + SATMP + LE++R F
Sbjct: 176 RQSLRPDYIKMFVLDEADEMLSRGFKDQIYDIFQLLPSKIQVGVFSATMPPEALEITRKF 235

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH 512
           M  PVRILV+++ELTLEGIKQFY++
Sbjct: 236 MNKPVRILVKRDELTLEGIKQFYVN 260



 Score = 33.1 bits (72), Expect = 0.25
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIH---CLLHKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N +   WKL   C ++    +   + F  T   + DWLT+ M  RD TVSA HG
Sbjct: 259 VNVEKEEWKLDTLCDLYETLAITQSVIFVNTR-RKVDWLTDKMRGRDHTVSATHG 312


>02_01_0355 +
           2558792-2558862,2558993-2559099,2559185-2559615,
           2560100-2560735
          Length = 414

 Score =  164 bits (399), Expect = 6e-41
 Identities = 97/207 (46%), Positives = 128/207 (61%), Gaps = 4/207 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATF   ILQQ+D  + ECQ+L+LAPTRELAQQI+KV+ ALGD+L  K HAC+GGT+V
Sbjct: 90  GKTATFCSGILQQLDYGLVECQSLVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSV 149

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
           RED R L SGVHVVVGTPGRV+DM+      P   + + +  L +    +SR        
Sbjct: 150 REDQRILASGVHVVVGTPGRVFDMLRRQSLRP---DHIKMFVLDEADEMLSRGFKDQIYD 206

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EIL---YAYLYRRKSLPWKVLNNF-TCIELEEW 528
             QL+       +    M  + L+   + +      L +R  L  + +  F   +E E+W
Sbjct: 207 IFQLLPPKIQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEDW 266

Query: 529 KLETLCDLYDTLSIAQAVIFCNTRRKV 609
           KL+TLCDLY+TL+I Q+VIF NTRRKV
Sbjct: 267 KLDTLCDLYETLAITQSVIFVNTRRKV 293



 Score =  117 bits (282), Expect = 9e-27
 Identities = 54/85 (63%), Positives = 72/85 (84%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R++L  + IK+FVLDEADEMLSRGFKDQI+D+F++L   +QV + SATMP + LE++R F
Sbjct: 176 RQSLRPDHIKMFVLDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATMPPEALEITRKF 235

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH 512
           M  PVRILV+++ELTLEGIKQFY++
Sbjct: 236 MNKPVRILVKRDELTLEGIKQFYVN 260



 Score = 33.9 bits (74), Expect = 0.14
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIH---CLLHKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N +   WKL   C ++    +   + F  T   + DWLT+ M  RD TVSA HG
Sbjct: 259 VNVEKEDWKLDTLCDLYETLAITQSVIFVNTR-RKVDWLTDKMRSRDHTVSATHG 312


>03_05_0052 -
           20293197-20293310,20293938-20294024,20294133-20294270,
           20295009-20295128,20295236-20295343,20296053-20296133,
           20296216-20296456,20297010-20297305
          Length = 394

 Score =  160 bits (388), Expect = 1e-39
 Identities = 93/208 (44%), Positives = 127/208 (61%), Gaps = 5/208 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT+  S+S+ Q +DT++RE QALIL+PTRELA Q ++V++A+GD++N + HACIGG ++
Sbjct: 80  GKTSMISLSVCQIVDTAVREVQALILSPTRELAAQTERVMLAIGDYINIQVHACIGGKSI 139

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
            EDIR+LE GVHVV GTPGRV DMI            L L +  +      + +     R
Sbjct: 140 GEDIRKLEHGVHVVSGTPGRVCDMIKRRTLRTRAIKLLILDEADEMLGRGFKDQIYDVYR 199

Query: 361 FC--QLMFKSYYSLLP--CLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNN-FTCIELEE 525
           +   +L      + LP   L M  K++     I    L +R  L  + +   F  +E EE
Sbjct: 200 YLPPELQVCLISATLPHEILEMTSKFMTDPVRI----LVKRDELTLEGIKQFFVAVEKEE 255

Query: 526 WKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           WK +TLCDLYDTL+I QAVIFCNT+RKV
Sbjct: 256 WKFDTLCDLYDTLTITQAVIFCNTKRKV 283



 Score =  115 bits (276), Expect = 5e-26
 Identities = 52/84 (61%), Positives = 69/84 (82%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR L    IKL +LDEADEML RGFKDQI+DV++ L  ++QV L+SAT+P ++LE++  F
Sbjct: 166 RRTLRTRAIKLLILDEADEMLGRGFKDQIYDVYRYLPPELQVCLISATLPHEILEMTSKF 225

Query: 438 MRDPVRILVQKEELTLEGIKQFYM 509
           M DPVRILV+++ELTLEGIKQF++
Sbjct: 226 MTDPVRILVKRDELTLEGIKQFFV 249



 Score = 34.7 bits (76), Expect = 0.082
 Identities = 14/19 (73%), Positives = 15/19 (78%)
 Frame = +2

Query: 611 DWLTESMHLRDFTVSAMHG 667
           DWLTE M   +FTVSAMHG
Sbjct: 284 DWLTERMRSNNFTVSAMHG 302


>01_06_0020 +
           25630728-25631023,25631308-25631548,25631629-25631709,
           25632109-25632216,25632329-25632448,25632806-25632943,
           25633064-25633150,25633802-25633915
          Length = 394

 Score =  159 bits (385), Expect = 3e-39
 Identities = 93/208 (44%), Positives = 126/208 (60%), Gaps = 5/208 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT+  S+S+ Q +DT++RE QALIL+PTRELA Q ++V++A+GD +N + HACIGG ++
Sbjct: 80  GKTSMISLSVCQIVDTAVREVQALILSPTRELAAQTERVMLAIGDFINIQVHACIGGKSI 139

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
            EDIR+LE GVHVV GTPGRV DMI            L L +  +      + +     R
Sbjct: 140 GEDIRKLEHGVHVVSGTPGRVCDMIKRRTLRTRAIKLLILDEADEMLGRGFKDQIYDVYR 199

Query: 361 FC--QLMFKSYYSLLP--CLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNN-FTCIELEE 525
           +   +L      + LP   L M  K++     I    L +R  L  + +   F  +E EE
Sbjct: 200 YLPPELQVCLISATLPHEILEMTSKFMTDPVRI----LVKRDELTLEGIKQFFVAVEKEE 255

Query: 526 WKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           WK +TLCDLYDTL+I QAVIFCNT+RKV
Sbjct: 256 WKFDTLCDLYDTLTITQAVIFCNTKRKV 283



 Score =  115 bits (276), Expect = 5e-26
 Identities = 52/84 (61%), Positives = 69/84 (82%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR L    IKL +LDEADEML RGFKDQI+DV++ L  ++QV L+SAT+P ++LE++  F
Sbjct: 166 RRTLRTRAIKLLILDEADEMLGRGFKDQIYDVYRYLPPELQVCLISATLPHEILEMTSKF 225

Query: 438 MRDPVRILVQKEELTLEGIKQFYM 509
           M DPVRILV+++ELTLEGIKQF++
Sbjct: 226 MTDPVRILVKRDELTLEGIKQFFV 249



 Score = 34.7 bits (76), Expect = 0.082
 Identities = 14/19 (73%), Positives = 15/19 (78%)
 Frame = +2

Query: 611 DWLTESMHLRDFTVSAMHG 667
           DWLTE M   +FTVSAMHG
Sbjct: 284 DWLTERMRSNNFTVSAMHG 302


>02_02_0099 + 6768115-6768285,6769950-6770034,6770501-6770628,
            6771429-6771465,6773108-6774193,6774337-6774447,
            6774701-6774817,6774818-6775120,6776092-6776513,
            6776645-6777274
          Length = 1029

 Score =  101 bits (242), Expect = 6e-22
 Identities = 69/204 (33%), Positives = 101/204 (49%), Gaps = 4/204 (1%)
 Frame = +1

Query: 1    GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
            G T T    ILQ++D +  ECQAL+L PT +LA + Q V+  LG  L+AK HA  GGT+ 
Sbjct: 708  GTTVTLCCGILQRLDYASTECQALVLVPTHDLAHETQNVIGVLGQFLSAKAHAFCGGTSA 767

Query: 181  REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMK----LMKCCPEVSRTRSM 348
             ED + L +GV V VGTP  V  M+      P       L +    L     ++      
Sbjct: 768  HEDQQILSTGVQVAVGTPCHVLGMLQGRALCPDHIRMFVLDEADEVLRGFKDQIHGIIQF 827

Query: 349  MSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCIELEEW 528
            + ++  Q  F S       L M  KY++   EI+       + +   V   +  +E E+ 
Sbjct: 828  LPTK-TQFGFFSASMSHEALEMCRKYMNKPVEIIVPRDEELEGI--NVKQFYVNVEKEDC 884

Query: 529  KLETLCDLYDTLSIAQAVIFCNTR 600
            KL+ LC L+DT+ I +++IF NTR
Sbjct: 885  KLDKLCGLFDTMEITRSIIFVNTR 908



 Score = 76.6 bits (180), Expect = 2e-14
 Identities = 43/86 (50%), Positives = 58/86 (67%), Gaps = 2/86 (2%)
 Frame = +3

Query: 261  RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM 440
            RAL  + I++FVLDEADE+L RGFKDQIH + + L    Q    SA+M  + LE+ R +M
Sbjct: 795  RALCPDHIRMFVLDEADEVL-RGFKDQIHGIIQFLPTKTQFGFFSASMSHEALEMCRKYM 853

Query: 441  RDPVRILVQKEELTLEGI--KQFYMH 512
              PV I+V ++E  LEGI  KQFY++
Sbjct: 854  NKPVEIIVPRDE-ELEGINVKQFYVN 878


>04_04_0613 +
           26617677-26617963,26618726-26618786,26619598-26619832,
           26619958-26620196,26620493-26620744,26620844-26621024,
           26621810-26621898,26622200-26622273,26622365-26622443
          Length = 498

 Score = 84.6 bits (200), Expect = 8e-17
 Identities = 66/210 (31%), Positives = 98/210 (46%), Gaps = 5/210 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F I  L++ID      Q +IL PTRELA Q  +V   LG HL  +     GGT++
Sbjct: 173 GKTAAFCIPALEKIDQDKNAIQVVILVPTRELALQTSQVCKELGKHLKIQVMVTTGGTSL 232

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCC-----PEVSRTRS 345
           ++DI +L   VH++VGTPGR+ D+      +    + L + +  K       P +     
Sbjct: 233 KDDIVRLYQPVHLLVGTPGRILDLTKKGVCVLKNCSMLVMDEADKLLSPEFQPSIQELIR 292

Query: 346 MMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCIELEE 525
            + S    LMF + +   P  +  +K  D      Y  +     L  K +  F     E 
Sbjct: 293 YLPSNRQILMFSATF---PVTVKEFK--DKYLPKPYV-INLMDELTLKGITQFYAFVEER 346

Query: 526 WKLETLCDLYDTLSIAQAVIFCNTRRKVGL 615
            K+  L  L+  L I Q++IFCN+  +V L
Sbjct: 347 QKVHCLNTLFSKLQINQSIIFCNSVNRVEL 376



 Score = 54.4 bits (125), Expect = 9e-08
 Identities = 27/73 (36%), Positives = 46/73 (63%)
 Frame = +3

Query: 288 LFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQ 467
           + V+DEAD++LS  F+  I ++ + L ++ Q+++ SAT P  V E    ++  P  ++  
Sbjct: 269 MLVMDEADKLLSPEFQPSIQELIRYLPSNRQILMFSATFPVTVKEFKDKYLPKPY-VINL 327

Query: 468 KEELTLEGIKQFY 506
            +ELTL+GI QFY
Sbjct: 328 MDELTLKGITQFY 340


>02_05_0096 +
           25785995-25786311,25786716-25786776,25787825-25788059,
           25788292-25788530,25789700-25789951,25790043-25790223,
           25790864-25790952,25791269-25791342,25791481-25791584,
           25791919-25791957,25792324-25792436
          Length = 567

 Score = 84.6 bits (200), Expect = 8e-17
 Identities = 66/210 (31%), Positives = 99/210 (47%), Gaps = 5/210 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F I  L++ID      Q +IL PTRELA Q  +V   LG HL  +     GGT++
Sbjct: 183 GKTAAFCIPALEKIDQEKNAIQVVILVPTRELALQTSQVCKELGKHLKIQVMVTTGGTSL 242

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCC-----PEVSRTRS 345
           ++DI +L   VH++VGTPGR+ D+      +    + L + +  K       P V +   
Sbjct: 243 KDDIIRLYQPVHLLVGTPGRILDLTKKGICILKDCSMLIMDEADKLLSPEFQPSVEQLIR 302

Query: 346 MMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCIELEE 525
            + +    LMF + +   P  +  +K  D      Y  +     L  K +  F     E 
Sbjct: 303 YLPASRQILMFSATF---PVTVKEFK--DKYLPKPYV-INLMDELTLKGITQFYAFVEER 356

Query: 526 WKLETLCDLYDTLSIAQAVIFCNTRRKVGL 615
            K+  L  L+  L I Q++IFCN+  +V L
Sbjct: 357 QKVHCLNTLFSKLQINQSIIFCNSVNRVEL 386



 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 26/73 (35%), Positives = 44/73 (60%)
 Frame = +3

Query: 288 LFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQ 467
           + ++DEAD++LS  F+  +  + + L A  Q+++ SAT P  V E    ++  P  ++  
Sbjct: 279 MLIMDEADKLLSPEFQPSVEQLIRYLPASRQILMFSATFPVTVKEFKDKYLPKPY-VINL 337

Query: 468 KEELTLEGIKQFY 506
            +ELTL+GI QFY
Sbjct: 338 MDELTLKGITQFY 350


>10_08_0553 -
           18720436-18720494,18721102-18721106,18721136-18721257,
           18721390-18721478,18722136-18722316,18722403-18722654,
           18722755-18722993,18723680-18723914,18724072-18724132,
           18724632-18724987
          Length = 532

 Score = 83.4 bits (197), Expect = 2e-16
 Identities = 64/210 (30%), Positives = 99/210 (47%), Gaps = 5/210 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F I  L++ID      Q +IL PTRELA Q  +V   LG +LN +     GGT++
Sbjct: 196 GKTAAFCIPALEKIDPEKNAIQVVILVPTRELALQTSQVCKELGKYLNIQVMVSTGGTSL 255

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCC-----PEVSRTRS 345
           ++DI +L   VH++VGTPGR+ D+      +    + L + +  K       P + +   
Sbjct: 256 KDDIMRLYQPVHLLVGTPGRILDLTRKGICVLKDCSMLVMDEADKLLAPEFQPSIEQLIH 315

Query: 346 MMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCIELEE 525
            + +    LMF + +  +       KYL       Y  +     L  K +  +     E 
Sbjct: 316 FLPANRQLLMFSATFP-VTVKDFKEKYLPR----PYV-INLMDELTLKGITQYYAFVEER 369

Query: 526 WKLETLCDLYDTLSIAQAVIFCNTRRKVGL 615
            K+  L  L+  L I Q++IFCN+  +V L
Sbjct: 370 QKVHCLNTLFSKLQINQSIIFCNSVNRVEL 399



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 25/73 (34%), Positives = 44/73 (60%)
 Frame = +3

Query: 288 LFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQ 467
           + V+DEAD++L+  F+  I  +   L A+ Q+++ SAT P  V +    ++  P  ++  
Sbjct: 292 MLVMDEADKLLAPEFQPSIEQLIHFLPANRQLLMFSATFPVTVKDFKEKYLPRPY-VINL 350

Query: 468 KEELTLEGIKQFY 506
            +ELTL+GI Q+Y
Sbjct: 351 MDELTLKGITQYY 363


>07_03_1566 +
           27766336-27766393,27766480-27766609,27766728-27766797,
           27767134-27767196,27767741-27767815,27768035-27768154,
           27768508-27768549,27768651-27768725,27768909-27769055,
           27769165-27769302,27769448-27769562,27769658-27769746,
           27770062-27770184
          Length = 414

 Score = 66.1 bits (154), Expect = 3e-11
 Identities = 39/85 (45%), Positives = 49/85 (57%), Gaps = 2/85 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQI-DTSIRECQ-ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 174
           GKTA F++ I+Q + +   R C  A +LAPTRELA QI K   ALG  ++ +C   IGG 
Sbjct: 32  GKTAAFALPIIQALLEHEHRPCFFACVLAPTRELAIQIAKQFEALGSAISLQCSVLIGGI 91

Query: 175 NVREDIRQLESGVHVVVGTPGRVYD 249
                   L    HVVVGTPGR+ D
Sbjct: 92  PRTSQTISLAKRPHVVVGTPGRLLD 116



 Score = 51.6 bits (118), Expect = 7e-07
 Identities = 22/75 (29%), Positives = 45/75 (60%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVR 455
           N +K  VLDEAD++L   F+  + D+  ++  + +  L SATM + V ++ R  +++PV+
Sbjct: 127 NKLKYLVLDEADDLLKVDFQKAVDDILNVIPKERRTFLFSATMTEKVKKLRRACLKNPVK 186

Query: 456 ILVQKEELTLEGIKQ 500
           + V  +   ++ ++Q
Sbjct: 187 VEVASKYSLVDTLRQ 201


>07_03_1392 -
           26238885-26239007,26239137-26239235,26239636-26239720,
           26239825-26240028,26240360-26240682,26241904-26242575
          Length = 501

 Score = 65.7 bits (153), Expect = 4e-11
 Identities = 37/85 (43%), Positives = 48/85 (56%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F++ IL ++        AL LAPTRELA Q+ +   ALG  L  +C A IGG + 
Sbjct: 126 GKTAAFALPILHRLGEDPYGVAALALAPTRELAAQLAEQFRALGAPLGLRCLAAIGGFDS 185

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
               + L    HVVV TPGR+  +I
Sbjct: 186 LGQAKGLARRPHVVVATPGRIATLI 210



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 22/76 (28%), Positives = 37/76 (48%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILV 464
           K  VLDEAD +L   F++ +  +F  L    Q  L SAT+ D++  +      +      
Sbjct: 224 KFLVLDEADRVLDINFEEDLRVIFGSLPKKRQTFLFSATISDNLRSLLELSGNNSYFFEA 283

Query: 465 QKEELTLEGIKQFYMH 512
            +   T++ +KQ Y+H
Sbjct: 284 YEGFKTVDTLKQLYIH 299


>12_02_1076 -
           25862671-25863159,25863290-25863451,25863614-25863838,
           25863939-25864037,25864584-25864992,25865094-25865221,
           25865955-25866329
          Length = 628

 Score = 64.5 bits (150), Expect = 9e-11
 Identities = 38/91 (41%), Positives = 53/91 (58%), Gaps = 6/91 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQI------DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKT  F I IL  I      ++  +   A++LAPTRELA+Q+++      D  N +    
Sbjct: 147 GKTLAFGIPILDAIIRHNEKNSPGKFPLAIVLAPTRELAKQVER---EFSDSSNVETICV 203

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            GGT + + IRQL  GV VV+GTPGRV D++
Sbjct: 204 YGGTPISQQIRQLNYGVDVVIGTPGRVIDLL 234



 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 29/84 (34%), Positives = 52/84 (61%), Gaps = 2/84 (2%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R AL+ + ++  VLDEAD+MLS GF + +  +   +    Q ++ SATMP  +  +++ +
Sbjct: 236 RGALNLSEVRFVVLDEADQMLSVGFDEDVETILDRVPPKRQTLMFSATMPTWIQRLTQKY 295

Query: 438 MRDPVRI-LVQKEELTL-EGIKQF 503
           +++PV I LV +++  L EGI  +
Sbjct: 296 LKNPVTIDLVGEDDQKLAEGISLY 319


>11_06_0767 +
           27121761-27123335,27123701-27123910,27124843-27124911,
           27125387-27125656,27126027-27126377,27126480-27126757,
           27126887-27128330
          Length = 1398

 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 31/77 (40%), Positives = 43/77 (55%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+LAPTRELA QIQ   +  G      C    GGT+    +R+LE G  +VV TPGR+ D
Sbjct: 680 LVLAPTRELASQIQDEAVKFGRSSRVSCTCLYGGTSKGLQLRELERGADIVVATPGRLND 739

Query: 250 MILVVRFMPTPSNFLFL 300
           ++ + +      +FL L
Sbjct: 740 ILEMRKISLHQVSFLVL 756



 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 21/66 (31%), Positives = 39/66 (59%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM 440
           R +  + +   VLDEAD ML  GF+ QI  +   +  + Q ++ +AT P +V +++   +
Sbjct: 744 RKISLHQVSFLVLDEADRMLDMGFEPQIRKIVDEIPRNRQTLMYTATWPKEVTKIAGDLL 803

Query: 441 RDPVRI 458
           +DPV++
Sbjct: 804 KDPVQV 809


>07_02_0023 -
           11918735-11918827,11919139-11919231,11919320-11919484,
           11920234-11920327,11921012-11921136,11921228-11921313,
           11921786-11921864,11923777-11923857,11924153-11924260,
           11924870-11924994,11925110-11925530
          Length = 489

 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 36/92 (39%), Positives = 48/92 (52%), Gaps = 7/92 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQA-------LILAPTRELAQQIQKVVIALGDHLNAKCHA 159
           GKT  F +  L  +   + E  A       L+L+PTRELAQQI  V+   G         
Sbjct: 141 GKTIAFGVPALMHVRRKMGEKSAKKGVPRVLVLSPTRELAQQIADVLCEAGAPCGISSVC 200

Query: 160 CIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
             GGT+    I  L+SGV +V+GTPGR+ D+I
Sbjct: 201 LYGGTSKGPQISALKSGVDIVIGTPGRMKDLI 232



 Score = 48.0 bits (109), Expect = 8e-06
 Identities = 22/69 (31%), Positives = 42/69 (60%), Gaps = 1/69 (1%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM-RDPV 452
           N +   VLDEAD ML  GF+ ++  +    ++  Q ++ SAT P  V ++++ FM  +P+
Sbjct: 240 NDVSFVVLDEADRMLDMGFEPEVRAILSQTASVRQTVMFSATWPPAVHQLAQEFMDPNPI 299

Query: 453 RILVQKEEL 479
           ++++  E+L
Sbjct: 300 KVVIGSEDL 308


>02_01_0765 -
           5694535-5694644,5695039-5696550,5697229-5697390,
           5698015-5698057
          Length = 608

 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 33/93 (35%), Positives = 54/93 (58%), Gaps = 7/93 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE-CQ------ALILAPTRELAQQIQKVVIALGDHLNAKCHA 159
           GKTA+F + I+        E C       A++LAPTREL  Q+++    LG  L  K   
Sbjct: 231 GKTASFLVPIIAHCSHVRSERCTDKQGPLAIVLAPTRELCLQVEEQAKVLGKGLPFKTAL 290

Query: 160 CIGGTNVREDIRQLESGVHVVVGTPGRVYDMIL 258
            +GG  + + I ++E+G+ ++VGTPGR+ D+++
Sbjct: 291 VVGGDPLAQQIYRIENGIELIVGTPGRLIDLLM 323



 Score = 51.2 bits (117), Expect = 9e-07
 Identities = 26/75 (34%), Positives = 44/75 (58%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVR 455
           N + +FVLDE D +L RGF+DQ+  +F+ LS   QV++ SAT+  +V ++S    ++ + 
Sbjct: 330 NKVDVFVLDEVDCLLERGFRDQVMQIFQALS-HPQVMMFSATVNSEVEKMSNSLAKNAIH 388

Query: 456 ILVQKEELTLEGIKQ 500
           I         + +KQ
Sbjct: 389 ISCGNPSRPNKSVKQ 403


>01_05_0296 +
           20567259-20567386,20568895-20569123,20569205-20569436,
           20569583-20569701,20570321-20570377,20570455-20570639,
           20571416-20571560,20571630-20571713,20571798-20571861,
           20571889-20571932
          Length = 428

 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 31/83 (37%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEML-SRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           L    ++ F+LDE D+ML S   +  + ++FK+   D QV++ SAT+  ++  V + FM+
Sbjct: 176 LSLKNVRHFILDECDKMLDSLDMRRDVQEIFKMTPHDKQVMMFSATLSKEIRPVCKKFMQ 235

Query: 444 DPVRILVQKE-ELTLEGIKQFYM 509
           DP+ I V  E +LTL G+ Q Y+
Sbjct: 236 DPMEIYVDDEAKLTLHGLVQHYI 258



 Score = 54.8 bits (126), Expect = 7e-08
 Identities = 34/83 (40%), Positives = 46/83 (55%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F +S LQQID    +  AL+L  TRELA QI         +L   K     GG +
Sbjct: 85  GKTAVFVLSSLQQIDPVAGQVGALVLCHTRELAYQICHEFERFSKYLPEVKVAVFYGGVH 144

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++    L++   H+VVGTPGR+
Sbjct: 145 IKKHKDLLKNDCPHIVVGTPGRI 167


>01_05_0295 +
           20537147-20537291,20539111-20539283,20539365-20539596,
           20539743-20539861,20540480-20540536,20540615-20540799,
           20542252-20542396,20542463-20542546,20542634-20542697,
           20542799-20542809
          Length = 404

 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 31/83 (37%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEML-SRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           L    ++ F+LDE D+ML S   +  + ++FK+   D QV++ SAT+  ++  V + FM+
Sbjct: 163 LSLKNVRHFILDECDKMLDSLDMRRDVQEIFKMTPHDKQVMMFSATLSKEIRPVCKKFMQ 222

Query: 444 DPVRILVQKE-ELTLEGIKQFYM 509
           DP+ I V  E +LTL G+ Q Y+
Sbjct: 223 DPMEIYVDDEAKLTLHGLVQHYI 245



 Score = 54.8 bits (126), Expect = 7e-08
 Identities = 34/83 (40%), Positives = 46/83 (55%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F +S LQQID    +  AL+L  TRELA QI         +L   K     GG +
Sbjct: 72  GKTAVFVLSSLQQIDPVAGQVGALVLCHTRELAYQICHEFERFSKYLPEVKVAVFYGGVH 131

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++    L++   H+VVGTPGR+
Sbjct: 132 IKKHKDLLKNDCPHIVVGTPGRI 154


>03_06_0531 +
           34552206-34552598,34552665-34552735,34553363-34553369,
           34553603-34553736,34553834-34554245,34554655-34554753,
           34555059-34555283,34555652-34556029,34556412-34556555,
           34556832-34556927,34557228-34557547,34557965-34558040
          Length = 784

 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 33/82 (40%), Positives = 53/82 (64%), Gaps = 2/82 (2%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           +L    +K  VLDEAD+ML+ GF++ +  + + L A+ Q +L SATMP  V ++SR ++ 
Sbjct: 273 SLQLGEVKYLVLDEADQMLAVGFEEDVETILQQLPAERQSMLFSATMPGWVKKLSRRYLN 332

Query: 444 DPVRI-LV-QKEELTLEGIKQF 503
           +P+ I LV  ++E   EGIK +
Sbjct: 333 NPLTIDLVGDQDEKLAEGIKLY 354



 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 36/93 (38%), Positives = 51/93 (54%), Gaps = 8/93 (8%)
 Frame = +1

Query: 1   GKTATFSISILQQI-----DTSIRECQ---ALILAPTRELAQQIQKVVIALGDHLNAKCH 156
           GKT  F I +++Q+       S+R  +    L+LAPTRELA+Q++K +      L+  C 
Sbjct: 179 GKTLAFGIPMIKQLMEEDDGRSVRRGRIPRVLVLAPTRELAKQVEKEIKESAPKLSTVC- 237

Query: 157 ACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
              GG +       L  GV VVVGTPGR+ D+I
Sbjct: 238 -VYGGVSYNVQQNALSRGVDVVVGTPGRIIDLI 269


>07_01_0322 -
           2258067-2258519,2258620-2258781,2258896-2259159,
           2259196-2259294,2259723-2260131,2260223-2260350,
           2261115-2261181,2262766-2262838,2262911-2263130
          Length = 624

 Score = 58.4 bits (135), Expect = 6e-09
 Identities = 38/91 (41%), Positives = 52/91 (57%), Gaps = 6/91 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQI------DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKT  F I I+ +I      + S R   A+ILAPTRELA+Q++K        L++ C   
Sbjct: 142 GKTLAFGIPIMDRILRHNEKNGSGRNPLAIILAPTRELARQVEKEFKESAP-LDSLC--V 198

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            GG  +   +R L  GV VVVGTPGR+ D++
Sbjct: 199 YGGVPISHQMRALNYGVDVVVGTPGRIIDLL 229



 Score = 54.4 bits (125), Expect = 9e-08
 Identities = 31/84 (36%), Positives = 52/84 (61%), Gaps = 2/84 (2%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  L+ + I+  VLDEAD+ML+ GF + +  + + L  + Q +L SATMP  + +++  +
Sbjct: 231 RGVLNLSEIQFVVLDEADQMLAVGFDEDVEVIMENLPQNRQSMLFSATMPSWIRKITSKY 290

Query: 438 MRDPVRI-LVQKEELTL-EGIKQF 503
           ++DP+ I LV  E+  L EGI  +
Sbjct: 291 LKDPIIIDLVGDEDQKLPEGISLY 314


>03_05_0619 -
           26180980-26181105,26181329-26181417,26181518-26181629,
           26181711-26181848,26182004-26182150,26182458-26182532,
           26182627-26182668,26183033-26183152,26183806-26183880,
           26184051-26184113,26184690-26184759,26184877-26185006,
           26185097-26185328
          Length = 472

 Score = 58.4 bits (135), Expect = 6e-09
 Identities = 32/85 (37%), Positives = 46/85 (54%), Gaps = 2/85 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQI--DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 174
           GKT  F++ I+Q +      +   A +L+PTRELA QI +   ALG  +   C   +GG 
Sbjct: 90  GKTGAFALPIIQALLKQDKPQALFACVLSPTRELAFQIGQQFEALGSAIGLSCTVLVGGV 149

Query: 175 NVREDIRQLESGVHVVVGTPGRVYD 249
           +  +    L    H+VVGTPGR+ D
Sbjct: 150 DRVQQAVSLAKRPHIVVGTPGRLLD 174



 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 26/78 (33%), Positives = 49/78 (62%), Gaps = 1/78 (1%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVR 455
           N +K  VLDEAD++L+  F+  + D+  ++  + +  L SATM + V ++ R  +R+PV+
Sbjct: 185 NKLKYLVLDEADKLLNVEFQKALDDILNVIPKERRTFLFSATMTNKVSKLQRACLRNPVK 244

Query: 456 ILVQKEELTLEGIKQ-FY 506
           + V  +  T++ ++Q FY
Sbjct: 245 VEVASKYSTVDTLRQEFY 262


>12_02_0340 -
           17725866-17725884,17726046-17726326,17726842-17726928,
           17727018-17727113,17728484-17728585,17728720-17728762,
           17728834-17728952,17729348-17729444,17730153-17730214,
           17730370-17730432,17730847-17730949,17731402-17731497,
           17731594-17731742,17732356-17732529,17733078-17733156,
           17733807-17733913,17733994-17734062,17734879-17735043,
           17735206-17735703
          Length = 802

 Score = 58.0 bits (134), Expect = 8e-09
 Identities = 30/86 (34%), Positives = 47/86 (54%), Gaps = 3/86 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQI---DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKTA FS+ +L+++      +   + LIL PTRELA Q+  ++  L    + +C   +GG
Sbjct: 243 GKTAAFSLPVLERLLFRPKRVPAIRVLILTPTRELAAQVHSMIEKLAQFTDIRCCLIVGG 302

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYD 249
            + +     L S   +VV TPGR+ D
Sbjct: 303 LSTKVQEVALRSMPDIVVATPGRIID 328



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 19/59 (32%), Positives = 35/59 (59%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           + + +LDEAD +L  GF  +I ++ ++     Q +L SATM +++ E+    +  PVR+
Sbjct: 341 LAILILDEADRLLELGFSAEIQELIRMCPRRRQTMLFSATMTEEINELVTLSLNKPVRL 399


>03_05_0865 - 28365430-28367640
          Length = 736

 Score = 58.0 bits (134), Expect = 8e-09
 Identities = 32/93 (34%), Positives = 52/93 (55%), Gaps = 8/93 (8%)
 Frame = +1

Query: 1   GKTATFSISILQQID-----TSIRECQ---ALILAPTRELAQQIQKVVIALGDHLNAKCH 156
           GKTA F + +L  I      +   E +   A+++APTRELAQQI++  +    +L  K  
Sbjct: 364 GKTAAFVLPMLSYITRLPPISEENEAEGPYAVVMAPTRELAQQIEEETVKFATYLGIKVV 423

Query: 157 ACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           + +GG ++ E   ++  G  VV+ TPGR+ D +
Sbjct: 424 SIVGGQSIEEQGFKIRQGCEVVIATPGRLLDCL 456



 Score = 33.1 bits (72), Expect = 0.25
 Identities = 26/86 (30%), Positives = 40/86 (46%), Gaps = 17/86 (19%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSA------------DVQVI----- 386
           RR    N     VLDEAD M+  GF+ Q+  V   + +            D + I     
Sbjct: 458 RRYAVLNQCNYVVLDEADRMIDMGFEPQVVGVLDAMPSSNLKPENEDEELDAKTIYRTTY 517

Query: 387 LLSATMPDDVLEVSRCFMRDPVRILV 464
           + SATMP  V  ++R ++R+PV + +
Sbjct: 518 MFSATMPPAVERLARKYLRNPVVVTI 543


>01_01_0682 -
           5244805-5244919,5246468-5246613,5246813-5246994,
           5247069-5247295,5247382-5247467,5247564-5247656,
           5247964-5248118,5248407-5248490,5248589-5248768,
           5249587-5249828,5249927-5249982
          Length = 521

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 26/66 (39%), Positives = 40/66 (60%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           +   VLDEAD ML  GF+ QI  +   +  D Q +  SAT P +V +++R F+ DP +++
Sbjct: 213 VTYLVLDEADRMLDMGFEPQIKKIVSQIRPDRQTLYWSATWPKEVEQLARNFLFDPYKVI 272

Query: 462 VQKEEL 479
           +  EEL
Sbjct: 273 IGSEEL 278



 Score = 28.3 bits (60), Expect(2) = 0.019
 Identities = 13/21 (61%), Positives = 15/21 (71%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALG 132
           L+LAPTRELA QIQ+     G
Sbjct: 168 LVLAPTRELAVQIQQEATKFG 188



 Score = 27.5 bits (58), Expect(2) = 0.019
 Identities = 10/16 (62%), Positives = 13/16 (81%)
 Frame = +1

Query: 208 GVHVVVGTPGRVYDMI 255
           GV +V+ TPGR+ DMI
Sbjct: 188 GVEIVIATPGRLIDMI 203


>03_02_0758 +
           10954268-10954841,10955988-10957145,10957176-10957216,
           10957412-10957448,10957534-10957954,10958201-10958234
          Length = 754

 Score = 54.8 bits (126), Expect = 7e-08
 Identities = 31/80 (38%), Positives = 42/80 (52%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM 440
           +AL        VLDEAD M   GF+ QI  +   +  D Q +L SATMP  V  ++R  +
Sbjct: 360 KALKMFRATYLVLDEADRMFDLGFEPQIRSIVGQIRPDRQTLLFSATMPYKVERLAREIL 419

Query: 441 RDPVRILVQKEELTLEGIKQ 500
            DP+R+ V +     E IKQ
Sbjct: 420 TDPIRVTVGQVGSANEDIKQ 439



 Score = 49.2 bits (112), Expect = 4e-06
 Identities = 29/90 (32%), Positives = 47/90 (52%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQI-DTSIRECQ----ALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA F + ++  I D    E +     ++ APTRELA QI           N +  A  
Sbjct: 268 GKTAAFVLPMIVHIMDQPELEKEEGPIGVVCAPTRELAHQIYLEAKKFAKPYNLRVAAVY 327

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG +  +  ++L++G  +V+ TPGR+ D++
Sbjct: 328 GGVSKFDQFKELKAGCEIVIATPGRLIDLL 357


>01_06_1758 -
           39681942-39682030,39682115-39682345,39682643-39682679,
           39683604-39683835,39683937-39684022,39684126-39684218,
           39684302-39684465,39684541-39684702,39684783-39684962,
           39685079-39685515,39685614-39685669
          Length = 588

 Score = 54.8 bits (126), Expect = 7e-08
 Identities = 28/62 (45%), Positives = 35/62 (56%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           LILAPTRELA QIQ+     G +   +     GG      IR L  GV +V+ TPGR+ D
Sbjct: 233 LILAPTRELAVQIQQESGKFGSYSRTRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLID 292

Query: 250 MI 255
           M+
Sbjct: 293 ML 294



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 23/69 (33%), Positives = 40/69 (57%), Gaps = 3/69 (4%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFK---ILSADVQVILLSATMPDDVLEVSRCFMRDPV 452
           +   VLDEAD ML  GF+ QI  +     ++  D Q +  SAT P +V  ++R F+++P 
Sbjct: 304 VTYLVLDEADRMLDMGFEPQIRKIVAQAWLIRPDRQTLYWSATWPREVESLARQFLQNPY 363

Query: 453 RILVQKEEL 479
           ++++   +L
Sbjct: 364 KVIIGSPDL 372


>08_01_0353 -
           3107628-3107774,3108177-3108213,3108248-3109164,
           3109210-3110952
          Length = 947

 Score = 54.4 bits (125), Expect = 9e-08
 Identities = 26/62 (41%), Positives = 36/62 (58%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           LI+APTREL  QI   +      L   C A  GG+ V + I +L+ G  +VV TPGR+ D
Sbjct: 362 LIMAPTRELVVQIHSDIKKFAKSLGINCVAIYGGSGVAQQISELKRGAEIVVCTPGRMID 421

Query: 250 MI 255
           ++
Sbjct: 422 IL 423



 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 24/73 (32%), Positives = 35/73 (47%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           +   V+DEAD M   GF+ QI  + +    D Q +L SA  P  V  ++R  +  PV I 
Sbjct: 436 VTFLVMDEADRMFDMGFEPQITRIVQNTRPDRQTVLFSAIFPRQVEILARKVLTKPVEIQ 495

Query: 462 VQKEELTLEGIKQ 500
           V    +  + I Q
Sbjct: 496 VGGRSVVNKDITQ 508


>08_01_0397 - 3509186-3510291,3510322-3512335
          Length = 1039

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 26/62 (41%), Positives = 36/62 (58%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           LI+APTREL  QI   +      L   C A  GG+ V + I +L+ G  +VV TPGR+ D
Sbjct: 501 LIMAPTRELVVQIHSDIKKFSKALGINCVAIYGGSGVAQQISELKRGAEIVVCTPGRMID 560

Query: 250 MI 255
           ++
Sbjct: 561 IL 562



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 25/73 (34%), Positives = 36/73 (49%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           +   V+DEAD M   GF+ QI  + +    D Q +L SAT P  V  ++R  +  PV I 
Sbjct: 575 VTFLVMDEADRMFDMGFEPQITRIVQNTRPDRQTVLFSATFPRQVEILARKVLTKPVEIQ 634

Query: 462 VQKEELTLEGIKQ 500
           V    +  + I Q
Sbjct: 635 VGGRSVVNKDITQ 647


>07_01_0725 -
           5532803-5533324,5533631-5533657,5534285-5534398,
           5534564-5534731,5535951-5536193,5537178-5537261,
           5537357-5538117,5539637-5539730,5540633-5540899,
           5541311-5541316,5542538-5542657
          Length = 801

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 25/63 (39%), Positives = 37/63 (58%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           ALIL+PTREL+ QI +           K     GG  + + +R+LE GV ++V TPGR+ 
Sbjct: 404 ALILSPTRELSVQIHEEARKFAYQTGVKVVVAYGGAPITQQLRELERGVEILVATPGRLM 463

Query: 247 DMI 255
           D++
Sbjct: 464 DLL 466



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 4/73 (5%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILS----ADVQVILLSATMPDDVLEV 425
           R  +    IK   LDEAD ML  GF+ QI  + + +      + Q +L SAT P ++  +
Sbjct: 468 RARVSLQMIKYLALDEADRMLDMGFEPQIRKIVEQMDMPPRGERQTMLFSATFPKEIQRM 527

Query: 426 SRCFMRDPVRILV 464
           +  F+ D + + V
Sbjct: 528 ASDFLADYIFLAV 540


>03_06_0365 -
           33399422-33399925,33400470-33400583,33400762-33400929,
           33401305-33401547,33402148-33402231,33402323-33403098,
           33404423-33404636
          Length = 700

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 24/63 (38%), Positives = 37/63 (58%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           ALIL+PTREL+ QI +           +     GG  + + +R+LE GV ++V TPGR+ 
Sbjct: 318 ALILSPTRELSVQIHEEARKFAYQTGVRVVVAYGGAPIHQQLRELERGVEILVATPGRLM 377

Query: 247 DMI 255
           D++
Sbjct: 378 DLL 380



 Score = 39.1 bits (87), Expect = 0.004
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 4/73 (5%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADV----QVILLSATMPDDVLEV 425
           R  +    +K   LDEAD ML  GF+ QI  + + +        Q +L SAT P ++  +
Sbjct: 382 RARVSLQMVKYLALDEADRMLDMGFEPQIRKIVEQMDMPPRGVRQTMLFSATFPKEIQRM 441

Query: 426 SRCFMRDPVRILV 464
           +  F+ D + + V
Sbjct: 442 ASDFLADYIFLAV 454


>11_06_0300 +
           22095396-22096145,22096261-22096344,22097062-22097304,
           22098535-22098702,22098895-22099008,22099378-22099890
          Length = 623

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 24/63 (38%), Positives = 36/63 (57%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           ALIL+PTREL+ QI +           +     GG  + + +R LE GV ++V TPGR+ 
Sbjct: 238 ALILSPTRELSMQIHEEARKFSYQTGVRVVVAYGGAPINQQLRDLERGVDILVATPGRLV 297

Query: 247 DMI 255
           D++
Sbjct: 298 DLL 300



 Score = 36.7 bits (81), Expect = 0.020
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 4/73 (5%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADV----QVILLSATMPDDVLEV 425
           R  +   +I+   LDEAD ML  GF+ Q+  + + +        Q +L SAT P ++  +
Sbjct: 302 RARVSLQSIRYLALDEADRMLDMGFEPQVRRIVEQMDMPPPGARQTMLFSATFPKEIQRM 361

Query: 426 SRCFMRDPVRILV 464
           +  F+ + + + V
Sbjct: 362 ASDFLENYIFLAV 374


>08_02_0671 -
           19890187-19890295,19891186-19891320,19891551-19891917,
           19892909-19893044,19894924-19894974,19895053-19895134,
           19895801-19895853,19895989-19896065,19896234-19896273,
           19897666-19897767,19897989-19898031,19898127-19899288,
           19899902-19900271
          Length = 908

 Score = 52.4 bits (120), Expect = 4e-07
 Identities = 27/83 (32%), Positives = 45/83 (54%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQI--DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 174
           GKTA F + ++Q++    +    +ALIL+PTR+LA Q  K    LG   + K    +GG 
Sbjct: 75  GKTAAFLVPMIQRLRRHDAGAGIRALILSPTRDLATQTLKFAQQLGKFTDLKISLIVGGD 134

Query: 175 NVREDIRQLESGVHVVVGTPGRV 243
           ++     +L     +++ TPGR+
Sbjct: 135 SMESQFEELAENPDIIIATPGRL 157



 Score = 51.6 bits (118), Expect = 7e-07
 Identities = 26/71 (36%), Positives = 42/71 (59%), Gaps = 2/71 (2%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L+  T++  V DEAD + S G   Q+HD+   LS   Q +L SAT+P  + + ++  +RD
Sbjct: 167 LNLRTVEYVVFDEADSLFSLGLIQQLHDILHKLSDTRQTLLFSATLPQALADFAKAGLRD 226

Query: 447 P--VRILVQKE 473
           P  VR+ + K+
Sbjct: 227 PQIVRLDLDKK 237


>01_01_0602 -
           4484972-4485450,4485949-4485997,4486108-4486237,
           4486636-4486778,4486819-4486877,4487167-4487200,
           4487489-4487629,4487719-4487907,4488027-4488122,
           4488163-4488225,4488588-4489097
          Length = 630

 Score = 52.4 bits (120), Expect = 4e-07
 Identities = 25/67 (37%), Positives = 38/67 (56%)
 Frame = +1

Query: 55  RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTP 234
           R  +A++L PTREL +Q+ +V  ++  H   +     GG+ +R     L   V +VVGTP
Sbjct: 207 RRPRAVVLCPTRELTEQVFRVAKSISHHARFRSTMVSGGSRIRPQEDSLNMPVDMVVGTP 266

Query: 235 GRVYDMI 255
           GR+ D I
Sbjct: 267 GRILDHI 273


>01_05_0292 +
           20518668-20519090,20519213-20519281,20520204-20520473,
           20520734-20521084,20521251-20521528,20522755-20523099,
           20523346-20523911,20525155-20525528
          Length = 891

 Score = 52.0 bits (119), Expect = 5e-07
 Identities = 29/77 (37%), Positives = 40/77 (51%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+LAPTRELA QI +  +  G           GG      +R L+ GV VVV TPGR+ D
Sbjct: 226 LVLAPTRELATQILEEAVKFGRSSRISSTCLYGGAPKGPQLRDLDRGVDVVVATPGRLND 285

Query: 250 MILVVRFMPTPSNFLFL 300
           ++ + R      ++L L
Sbjct: 286 ILEMRRISLKQVSYLVL 302



 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 21/68 (30%), Positives = 36/68 (52%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM 440
           R +    +   VLDEAD ML  GF+ QI  + K +    Q ++ +AT P +V  ++   +
Sbjct: 290 RRISLKQVSYLVLDEADRMLDMGFEPQIRKIVKEIPPRRQTLMYTATWPKEVRRIAEDLL 349

Query: 441 RDPVRILV 464
             PV++ +
Sbjct: 350 VHPVQVTI 357


>07_03_1500 +
           27001842-27002058,27002144-27002283,27002458-27002549,
           27002680-27002776,27002871-27002951,27003031-27003263,
           27003876-27004070,27004149-27004239,27004324-27004446,
           27004542-27004692,27005060-27005262
          Length = 540

 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 28/82 (34%), Positives = 45/82 (54%), Gaps = 1/82 (1%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILS-ADVQVILLSATMPDDVLEVSRC 434
           +R L  + ++  VLDE+D++   GF + I  V K  S   +   L SAT+PD +  ++R 
Sbjct: 280 KRDLDLSRVEYLVLDESDKLFELGFVEVIDSVVKACSNPSIIRSLFSATLPDSIETLART 339

Query: 435 FMRDPVRILVQKEELTLEGIKQ 500
            M D VR++V ++      IKQ
Sbjct: 340 IMHDAVRVIVGRKNSASSLIKQ 361



 Score = 32.3 bits (70), Expect = 0.44
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 1/36 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE-CQALILAPTRELAQQ 105
           GKT  F   IL +I    +E  +A+IL PTRELA Q
Sbjct: 195 GKTLAFLFPILMKIKPGSKEGVKAVILCPTRELAAQ 230


>07_03_0601 -
           19872780-19873099,19873148-19873151,19874196-19874357,
           19874429-19874617,19874687-19875010,19875103-19875378,
           19875436-19875478,19876110-19876188,19876473-19876555,
           19876708-19876782,19877324-19877490,19877960-19878370
          Length = 710

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 24/67 (35%), Positives = 41/67 (61%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           I++ V+DEAD++L + F++Q+ +V   L    Q +L SAT    V +++R  ++DP  I 
Sbjct: 377 IQILVIDEADQVLDKNFQEQVDNVVSQLPKVRQTLLFSATQTKSVKDLARVSLKDPEYIS 436

Query: 462 VQKEELT 482
           V +E  T
Sbjct: 437 VHEEATT 443


>06_03_0337 +
           19678152-19678484,19678616-19678801,19679232-19679417,
           19680840-19680926,19681045-19681086,19681164-19681253,
           19681399-19681503,19681797-19681835,19681914-19682018,
           19682463-19682531,19682587-19682736,19683156-19683335
          Length = 523

 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 32/87 (36%), Positives = 47/87 (54%), Gaps = 4/87 (4%)
 Frame = +1

Query: 1   GKTATF---SISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKT  F   +I +L ++  S R     ++L PTRELA Q   V   L  + +      IG
Sbjct: 135 GKTLAFLIPAIELLCRLRFSPRNGTGVIVLCPTRELAIQTHNVAKELMRYHSQTLGYVIG 194

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYD 249
           G ++R +  QL  G++V+V TPGR+ D
Sbjct: 195 GIDLRGEAEQLAKGINVLVATPGRLLD 221



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 26/85 (30%), Positives = 46/85 (54%), Gaps = 10/85 (11%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSAD-VQVILLSATMPDDVLEVSRCFM---RDP 449
           +K  ++DEAD +L + F++Q+  +FK+L     Q +L SAT  + V + ++       + 
Sbjct: 234 LKCLIIDEADRILEQNFEEQMKQIFKLLPRQGRQTVLFSATQTEKVEDFAKLTFGSKEER 293

Query: 450 VRILV------QKEELTLEGIKQFY 506
            R LV       + + T+EG+KQ Y
Sbjct: 294 QRTLVYVGVDDHESKATVEGLKQGY 318


>01_05_0722 +
           24598426-24598649,24599113-24599219,24599319-24599374,
           24599469-24599675,24599757-24599963,24600037-24600123,
           24600167-24600208,24600209-24600304,24600406-24600621,
           24600693-24600875,24601014-24601241
          Length = 550

 Score = 49.2 bits (112), Expect = 4e-06
 Identities = 24/74 (32%), Positives = 41/74 (55%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           +K+ VLDEAD +L  GF+  I  +   +  + Q +L SAT+P++V ++S   M+   + +
Sbjct: 224 VKVLVLDEADRLLDMGFRRDIEKIIAFIPKERQTLLFSATVPEEVRQISHIAMKRGYKFI 283

Query: 462 VQKEELTLEGIKQF 503
              +E   E   QF
Sbjct: 284 NTVKEGDEETHSQF 297



 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 28/87 (32%), Positives = 45/87 (51%), Gaps = 4/87 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE--CQALILAPTRELAQQI-QKVVIALGDHLNAKCHACIGG 171
           GKT  F +  ++ + T  R      L++ PTRELA Q+  +    L  H +      IGG
Sbjct: 123 GKTVAFLLPAIELLSTLPRSPSINLLVICPTRELANQVAAEARKLLKYHRSLGVQVVIGG 182

Query: 172 TNVREDIRQLESG-VHVVVGTPGRVYD 249
           T + ++ R ++S    ++V TPGR+ D
Sbjct: 183 TKLPQEQRSMQSNPCQILVATPGRLKD 209


>09_05_0008 +
           20042390-20042845,20043323-20043457,20043539-20043679,
           20043771-20043882,20044084-20044154,20044251-20044405,
           20044484-20044595,20044932-20045033,20045116-20045176,
           20045251-20045422,20045512-20045608,20045692-20045786,
           20045881-20046014,20046208-20046422
          Length = 685

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 24/62 (38%), Positives = 32/62 (51%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+L PTRELA+Q+       G           GG++ R     +  GV +VVGTPGRV D
Sbjct: 186 LVLLPTRELAKQVHTDFAFYGATFGLSACCVYGGSDYRSQEMAIRKGVDIVVGTPGRVKD 245

Query: 250 MI 255
            +
Sbjct: 246 FV 247



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILS--ADVQVILLSATMPDDVLEVSRCFM 440
           L+  ++K  VLDEADEML+ GF D +  +   +     VQ +L SAT+P+ V ++S  F+
Sbjct: 252 LNFRSLKFRVLDEADEMLNMGFVDDVELILGKVEDVTKVQTLLFSATIPEWVKKLSLRFL 311

Query: 441 R 443
           +
Sbjct: 312 K 312


>06_03_1255 + 28780181-28781172,28782065-28782932
          Length = 619

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 26/68 (38%), Positives = 43/68 (63%), Gaps = 6/68 (8%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVV-IALGDHLNA-----KCHACIGGTNVREDIRQLESGVHVVVGT 231
           LI+ P+RELA+Q  +V+ + L   + A     +   CIGG ++R  +  ++ GVH+VV T
Sbjct: 253 LIVCPSRELARQTHEVIEMFLAPLMEAGYPEIRPLLCIGGVDMRTQMEVVKKGVHIVVAT 312

Query: 232 PGRVYDMI 255
           PGR+ D++
Sbjct: 313 PGRLKDLL 320



 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 21/70 (30%), Positives = 40/70 (57%)
 Frame = +3

Query: 255 TRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRC 434
           +++ ++ +  +   LDEAD ++  GF+D I +VF    A  Q +L SATMP+ +   ++ 
Sbjct: 321 SKKKMNLDNCRYLTLDEADRLVDLGFEDDIREVFDHFKAQRQTLLFSATMPEKIQNFAKS 380

Query: 435 FMRDPVRILV 464
            +  P+ + V
Sbjct: 381 ALVKPIIVNV 390


>01_01_0509 -
           3713109-3713244,3713689-3713733,3713959-3714015,
           3714088-3714438,3714585-3714862,3714939-3715289,
           3715378-3715647,3716035-3716103,3716194-3716304,
           3716503-3716583,3716825-3716914,3717032-3717262
          Length = 689

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 34/104 (32%), Positives = 51/104 (49%), Gaps = 4/104 (3%)
 Frame = +1

Query: 1   GKTATFSIS---ILQQIDTSIRECQA-LILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKT  + I    +L+++  + R+    L+L+PTRELA QIQ      G           G
Sbjct: 229 GKTLGYLIPGFILLKRLQHNSRDGPTVLVLSPTRELATQIQDEAKKFGRSSRISSVCLYG 288

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFL 300
           G      +R LE G  +VV TPGR+ D++ + R      ++L L
Sbjct: 289 GAPKGPQLRDLERGADIVVATPGRLNDILEMRRVSLHQVSYLVL 332



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 21/66 (31%), Positives = 38/66 (57%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM 440
           R +  + +   VLDEAD ML  GF+ QI  + K +    Q ++ +AT P +V +++   +
Sbjct: 320 RRVSLHQVSYLVLDEADRMLDMGFEPQIRKIVKQVQPKRQTLMFTATWPKEVRKIASDLL 379

Query: 441 RDPVRI 458
            +PV++
Sbjct: 380 SNPVQV 385


>06_03_0287 -
           19168685-19168735,19168847-19168884,19169517-19169727,
           19171461-19171643,19171879-19172028,19172161-19172256,
           19172378-19172464,19172535-19172741,19172823-19173047,
           19173150-19173261,19173397-19173453,19175522-19176882
          Length = 925

 Score = 48.4 bits (110), Expect = 6e-06
 Identities = 23/65 (35%), Positives = 36/65 (55%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           +K+ +LDEAD +L  GF+  I  +   L    Q +L SAT+PD+V +V    M+  +  +
Sbjct: 611 VKVLILDEADRLLDMGFRTDIERIVAALPKQRQTLLFSATVPDEVRQVCHIAMKRDLEFV 670

Query: 462 VQKEE 476
              EE
Sbjct: 671 NTVEE 675


>01_01_0447 -
           3327727-3328144,3328438-3328688,3328820-3328909,
           3329061-3329159,3329240-3329353,3329450-3329555,
           3329661-3329740,3329913-3330173,3330271-3330507,
           3330635-3330922
          Length = 647

 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 24/69 (34%), Positives = 41/69 (59%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L+   +++ +LDEAD +L  GF+ QI  +   L    +  L SAT  + V E+++  +R+
Sbjct: 169 LNYKNLEILILDEADRLLDLGFQKQITSIISKLPKLRRTGLFSATQTEAVKELAKAGLRN 228

Query: 447 PVRILVQKE 473
           PVR+ V+ E
Sbjct: 229 PVRVEVKTE 237



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 26/92 (28%), Positives = 51/92 (55%), Gaps = 7/92 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQI-----DTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHAC 162
           GKT  F + +++ +          E   +I++PTREL+ QI  V       L        
Sbjct: 72  GKTLAFVVPVVEILRRRPSPPKPHEVLGIIISPTRELSSQIYNVAQPFFATLKGVSSMLL 131

Query: 163 IGGTNVREDIRQLES-GVHVVVGTPGRVYDMI 255
           +GG +++ ++++LE  G +++VGTPG+++D++
Sbjct: 132 VGGFDIKAELKKLEEEGANILVGTPGKLFDVM 163


>04_04_0476 -
           25508952-25509004,25509245-25509326,25509453-25509611,
           25509702-25509767,25509898-25510067,25510172-25510262,
           25510331-25510410,25510887-25511003,25511092-25511218,
           25511685-25511865,25511978-25512366,25512959-25513135,
           25513306-25513500,25513844-25514031,25514192-25514500,
           25514592-25514637
          Length = 809

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 23/64 (35%), Positives = 39/64 (60%)
 Frame = +1

Query: 64  QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRV 243
           +ALIL PTRELA+Q+   +      L  +    +GG ++ +  R L+    +VVGTPGR+
Sbjct: 233 RALILTPTRELAKQVCDHLKEAAKFLRIQVVPIVGGLSMEKQERLLKRKPEIVVGTPGRL 292

Query: 244 YDMI 255
           ++++
Sbjct: 293 WELM 296



 Score = 30.3 bits (65), Expect = 1.8
 Identities = 11/30 (36%), Positives = 20/30 (66%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKIL 365
           +++  FVLDEAD M+ RG   ++  + ++L
Sbjct: 307 HSLSFFVLDEADRMIERGHFHELQSIIEML 336


>01_05_0721 +
           24594815-24594834,24595207-24595313,24595417-24595472,
           24595562-24595810,24595871-24596077,24596157-24596243,
           24596331-24596426,24596500-24596715,24596908-24597090,
           24597222-24597449
          Length = 482

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 20/54 (37%), Positives = 34/54 (62%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           +K+ VLDEAD +L  GF+  I  +   +  + Q +L SAT+P++V ++S   M+
Sbjct: 170 VKVLVLDEADRLLDMGFRRDIERIIASVPKERQTLLFSATVPEEVRQISHIAMK 223



 Score = 33.9 bits (74), Expect = 0.14
 Identities = 29/103 (28%), Positives = 48/103 (46%), Gaps = 18/103 (17%)
 Frame = +1

Query: 1   GKTATF---SISILQQIDTSIRE-----CQALILAPTRELAQQIQ-KVVIALGDHLNAKC 153
           GKT  F   +I +L  +  S R+        L++ PTRELA Q+  +    L  H +   
Sbjct: 55  GKTVAFLLPAIEVLSALPNSRRDQLRPSINLLVMCPTRELAIQVAVEAKKLLKYHRSLGV 114

Query: 154 HACIGGTNVREDIRQLESGV---------HVVVGTPGRVYDMI 255
              IGGT + ++ R +++            ++V TPGR+ D +
Sbjct: 115 QVVIGGTRLTQEQRSMQANPCQVVPMNYRQILVATPGRLKDHV 157


>02_05_1293 -
           35520733-35520963,35521696-35521878,35522040-35522255,
           35522936-35523022,35523125-35523331,35523426-35523650,
           35523743-35523798,35524009-35524115,35524443-35525470
          Length = 779

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 22/54 (40%), Positives = 32/54 (59%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           +KL VLDEAD +L  GF+  I  +   L    Q +L SAT+P +V  VS+  ++
Sbjct: 498 LKLLVLDEADHLLDLGFRTDIEKIVDSLPRQRQTLLFSATIPKEVRRVSQLVLK 551



 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 2/65 (3%)
 Frame = +1

Query: 67  ALILAPTRELAQQI-QKVVIALGDHLNAKCHACIGGTNVREDIRQLESG-VHVVVGTPGR 240
           +LIL PTRELA Q+  +  + L  H      + IGGT  + D R+LES    ++V TPGR
Sbjct: 421 SLILCPTRELAIQLTAEANVLLKYHQGIGVQSLIGGTRFKLDQRRLESDPCQILVATPGR 480

Query: 241 VYDMI 255
           + D I
Sbjct: 481 LLDHI 485


>03_01_0399 +
           3097878-3098141,3098254-3098547,3098659-3098886,
           3099148-3099224,3099501-3099540,3099737-3099802,
           3100305-3100706,3100777-3100888,3101445-3101530,
           3101607-3101672
          Length = 544

 Score = 44.8 bits (101), Expect = 8e-05
 Identities = 21/54 (38%), Positives = 33/54 (61%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKT  F + +L ++D + +  QA+ + PTRELAQQ + V++ +G      C AC
Sbjct: 152 GKTTCFVLGMLSRVDPNRKVTQAICICPTRELAQQNKSVLMRMGKFTGITC-AC 204



 Score = 37.5 bits (83), Expect = 0.012
 Identities = 19/42 (45%), Positives = 28/42 (66%)
 Frame = +3

Query: 378 QVILLSATMPDDVLEVSRCFMRDPVRILVQKEELTLEGIKQF 503
           QV+L SAT  + V +     ++D  +I V+KEELTLE +KQ+
Sbjct: 323 QVLLFSATFNERVKDFVTRVIKDGNQIFVKKEELTLEKVKQY 364


>03_06_0344 -
           33276366-33276548,33277044-33277169,33277254-33277322,
           33277401-33277505,33277595-33277633,33277717-33278016,
           33278093-33278182,33278271-33278312,33278433-33278516,
           33278762-33278947,33279218-33279403,33279663-33280025
          Length = 590

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 27/84 (32%), Positives = 47/84 (55%), Gaps = 9/84 (10%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR-CFMRD---- 446
           +K  ++DEAD +L + F++ +  +FK L  + Q +L SAT  + V E ++  F ++    
Sbjct: 244 LKCLIIDEADRLLEQNFEEDMKQIFKRLPLNRQTVLFSATQTEQVKEFAKLSFEKNEEST 303

Query: 447 --PVRILVQKEE--LTLEGIKQFY 506
             PV + V   E   T+EG++Q Y
Sbjct: 304 SKPVYVGVDDAETNATVEGLQQGY 327



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 23/60 (38%), Positives = 33/60 (55%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           +++ PTRELA Q   V   L  + +      IGG   R +  QL  GV+++V TPGR+ D
Sbjct: 172 VVVCPTRELAIQTHNVAKELMKYHSQTLGYIIGGNGRRGEADQLAKGVNLLVATPGRLLD 231


>06_03_0674 +
           23422004-23422552,23423295-23423369,23424360-23424443,
           23424749-23424991,23425348-23425515,23425608-23425727,
           23426372-23427016
          Length = 627

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 4/73 (5%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILS----ADVQVILLSATMPDDVLEV 425
           R  +    IK  V+DEAD ML  GF+ QI  + + ++    +  Q +L SAT P ++  +
Sbjct: 260 RSKVSLEAIKYLVMDEADRMLDMGFEPQIRKIVERMNMPRKSVRQTMLFSATFPPEIQRL 319

Query: 426 SRCFMRDPVRILV 464
           +  F+ + + I V
Sbjct: 320 ASDFLSNYIFITV 332



 Score = 35.9 bits (79), Expect = 0.035
 Identities = 14/30 (46%), Positives = 20/30 (66%)
 Frame = +1

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GGT +   +R LE G  ++V TPGR+ DM+
Sbjct: 229 GGTPMYNQLRDLERGADILVATPGRLVDMV 258


>05_01_0079 +
           531617-531734,531987-532059,532152-532261,532400-532543,
           532628-532736,532836-533182,533260-533333,533478-533782,
           534168-534294,534385-534414,534589-534837
          Length = 561

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 1/62 (1%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACI-GGTNVREDIRQLESGVHVVVGTPGRV 243
           AL+L PTREL  Q+  +   L    +      I GG N  ++  +L  G+ +++ TPGR+
Sbjct: 101 ALVLVPTRELCLQVYGIAQQLVHRFHWLVPGYIMGGENRAKEKARLRKGISILIATPGRL 160

Query: 244 YD 249
            D
Sbjct: 161 LD 162


>02_05_0064 -
           25529630-25531440,25531663-25531673,25533113-25533198,
           25533412-25534259,25535385-25535736
          Length = 1035

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 26/81 (32%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = +1

Query: 64  QALILAPTRELAQQI-QKVVIALGDHLNAKCHACIGGTN-VREDIRQLESGVHVVVGTPG 237
           +A+I+AP+REL  QI ++V   LG +        +GG N  R++    ++   +VVGTPG
Sbjct: 674 EAVIVAPSRELGMQIVREVEKILGPNDKRLVQQLVGGANRSRQEEALKKNKPIIVVGTPG 733

Query: 238 RVYDMILVVRFMPTPSNFLFL 300
           R+ ++    +       FL L
Sbjct: 734 RISEISAAGKLHTHSCRFLVL 754



 Score = 37.9 bits (84), Expect = 0.009
 Identities = 24/81 (29%), Positives = 43/81 (53%), Gaps = 17/81 (20%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKIL-------SADV----------QVILLS 395
           LH ++ +  VLDE D++LS  +++ +H + + +       S D+          Q IL+S
Sbjct: 744 LHTHSCRFLVLDEVDQLLSFNYREDMHRILEHVGRKSGTSSRDILGPLARRSERQTILVS 803

Query: 396 ATMPDDVLEVSRCFMRDPVRI 458
           AT+P  V+  +R +  DPV +
Sbjct: 804 ATIPFSVIRAARSWGHDPVLV 824


>01_07_0333 -
           42813789-42814073,42814229-42814315,42815083-42815172,
           42815555-42815623,42815859-42815888,42816060-42816164,
           42816454-42816549,42816647-42816760,42816862-42816955,
           42817027-42817190
          Length = 377

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 17/39 (43%), Positives = 23/39 (58%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKV 117
           GKT  + +S+   ID      QAL++ PTREL  Q+ KV
Sbjct: 90  GKTLAYLLSVFSAIDFGRSSVQALVVVPTRELGMQVTKV 128


>03_02_0189 - 6253659-6255380
          Length = 573

 Score = 37.9 bits (84), Expect = 0.009
 Identities = 23/65 (35%), Positives = 39/65 (60%), Gaps = 2/65 (3%)
 Frame = +1

Query: 64  QALILAPTRELAQQI-QKVVIALGDHLNAKCHACIGGTN-VREDIRQLESGVHVVVGTPG 237
           +A+I+AP+REL  QI ++V   LG +        +GG N  R++    ++   +VVGTPG
Sbjct: 212 EAVIVAPSRELGMQIVREVEKILGPNDKRLVQQLVGGANRSRQEEALKKNKPLIVVGTPG 271

Query: 238 RVYDM 252
           R+ ++
Sbjct: 272 RISEI 276



 Score = 36.7 bits (81), Expect = 0.020
 Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 17/81 (20%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKIL-------SADV----------QVILLS 395
           LH +  +  VLDE D++LS  +++ +H + + +       S D+          Q IL+S
Sbjct: 282 LHTHGCRFLVLDEVDQLLSFNYREDMHRILEHVGRKSGTSSRDILGPLARRSERQTILVS 341

Query: 396 ATMPDDVLEVSRCFMRDPVRI 458
           AT+P  V+  +R +  DPV +
Sbjct: 342 ATIPFSVIRAARSWGHDPVLV 362


>12_01_0445 -
           3513733-3513819,3514392-3514613,3514730-3514999,
           3515033-3517110,3517649-3517976,3519136-3519255,
           3519299-3519352,3520115-3520154,3520344-3520411
          Length = 1088

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 14/53 (26%), Positives = 25/53 (47%)
 Frame = -3

Query: 442 LIKHRDTSNTSSGMVAESNMT*TSADKILKTSWIWSLKPLDNISSASSRTKSL 284
           +++  +TSN   G +  +    T    + +TSW+W  KP D     +  T S+
Sbjct: 31  VVEFEETSNLQLGELLINEKQHTVLMVMDRTSWLWRRKPSDKSPGGAENTVSV 83


>04_04_1535 + 34205426-34205593,34205697-34206869
          Length = 446

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 12/40 (30%), Positives = 21/40 (52%)
 Frame = -3

Query: 316 ISSASSRTKSLMVLA*SARRVSYHIHDLECPPPHEHHSPV 197
           +++AS     L+ LA +    + H+H + C P H H + V
Sbjct: 1   MAAASGHNARLLALALALLLAALHLHGVVCDPSHTHFAMV 40


>04_03_0653 - 18429736-18431379
          Length = 547

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 2/64 (3%)
 Frame = +1

Query: 28  ILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI--GGTNVREDIRQL 201
           IL ++DT      A +      LA++I  +V ++ D L  + HAC+   G     D R+L
Sbjct: 47  ILGRLDTRTALAAAALSRRLDRLAREIPALVFSVRDVLPPRYHACVRAHGDAAGADARKL 106

Query: 202 ESGV 213
           ++ +
Sbjct: 107 DAAI 110


>11_01_0192 - 1523572-1526097
          Length = 841

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 13/28 (46%), Positives = 17/28 (60%)
 Frame = +1

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILV 261
           V +D+RQ E   HV +   GR+Y M LV
Sbjct: 579 VLQDVRQSEDVFHVELSVIGRIYHMNLV 606


>03_05_0997 +
           29565311-29565664,29566134-29566298,29566572-29566661,
           29566763-29566891,29568141-29568272,29568904-29568969,
           29569326-29569505,29569664-29569693,29569744-29569839,
           29569959-29570096,29571060-29571142,29571447-29571484,
           29571568-29571788,29572491-29572538
          Length = 589

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 9/94 (9%)
 Frame = +1

Query: 1   GKTATFSISILQQI-----DTSIREC--QALILAPTRELAQQIQKVVIALGDHLNAKCHA 159
           GKT  + + +L ++     +  IR+      IL PTREL QQ+     +L +   +K   
Sbjct: 132 GKTFAYLLPMLHELLKLSAEGRIRKSAPNVFILVPTRELCQQVHNEASSLLEFCTSKLKV 191

Query: 160 C-IGGTNVREDIRQLESG-VHVVVGTPGRVYDMI 255
             +  +   +DI+   SG  +++V TP  V   I
Sbjct: 192 VQVNASMSDKDIKVALSGPPNILVTTPACVASCI 225


>01_07_0043 + 40699334-40700482
          Length = 382

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 16/45 (35%), Positives = 21/45 (46%)
 Frame = -1

Query: 645 KSRRCIDSVSQSHLATGVAENYSLCNRQCIIQVTQSFQLPFF*FN 511
           KS RCID     +L      N+   ++  II+V    QLP   FN
Sbjct: 20  KSLRCIDLTHHCNLFNATPPNFFNGSKSTIIRVENRIQLPSPIFN 64


>11_06_0683 + 26259129-26259968
          Length = 279

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 21/63 (33%), Positives = 31/63 (49%)
 Frame = -3

Query: 304 SSRTKSLMVLA*SARRVSYHIHDLECPPPHEHHSPVGEYLHGHWCHQCKHGI*HSSDHQE 125
           ++ T ++ V A +A  + YH+     PPP     P   Y H H+CH C HG  H +  + 
Sbjct: 199 TTTTTTIGVPAATAAYMHYHLSP---PPP----PPCYGY-HLHYCH-CTHGHCHCAGGRH 249

Query: 124 LSP 116
            SP
Sbjct: 250 YSP 252


>07_03_1304 -
           25629822-25629839,25630091-25631148,25631784-25634928,
           25635454-25636293
          Length = 1686

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 15/50 (30%), Positives = 22/50 (44%)
 Frame = -3

Query: 490 PSRVSSSFCTSMRTGSLIKHRDTSNTSSGMVAESNMT*TSADKILKTSWI 341
           P +    FCT++   SL          SG+  ES    +S   +LK +WI
Sbjct: 536 PGKRKIIFCTNIAETSLTIKEVKYVVDSGLAKESRFVPSSGLNVLKVNWI 585


>06_03_0996 + 26731442-26732121,26732573-26732772,26732930-26733330
          Length = 426

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 1/24 (4%)
 Frame = -3

Query: 223 PPHEHHSP-VGEYLHGHWCHQCKH 155
           PPHE  +P +G  LH H  HQ  H
Sbjct: 337 PPHESSAPQIGAMLHHHHHHQQDH 360


>05_06_0267 -
           26784861-26784896,26785324-26785404,26785530-26785702,
           26785780-26785938,26786199-26786328,26786447-26786609,
           26787027-26787109,26787605-26787664,26787819-26787940,
           26789126-26789275,26789354-26789546,26790156-26790393,
           26791240-26791320,26791403-26791647
          Length = 637

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 14/42 (33%), Positives = 25/42 (59%)
 Frame = +3

Query: 300 DEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEV 425
           ++ D MLS  +K  + D+   L+   Q +L  A++P DVL++
Sbjct: 572 EKKDAMLSYLWKINVVDIESTLTHVCQAVLKDASVPKDVLKL 613


>04_01_0545 + 7046861-7047955,7048822-7049436,7052887-7054692
          Length = 1171

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 29/96 (30%), Positives = 44/96 (45%), Gaps = 7/96 (7%)
 Frame = +1

Query: 73   ILAPTRELAQQIQKVVIALGDHLNAK--CHACIGGTNVREDIRQLESGVHVV----VGTP 234
            ILA    L +Q++K+ ++  +  N+K  CHA I   N+     QL+   HVV    +  P
Sbjct: 959  ILADIYRL-KQMRKLEVSGINRKNSKHLCHAIINHKNLESLSLQLDKEKHVVCWDDISPP 1017

Query: 235  GRVYDMILVVRF-MPTPSNFLFLMKLMKCCPEVSRT 339
              V  + L     M +   F  L  L K C E++ T
Sbjct: 1018 SSVRSLKLYGHVEMLSARRFKNLRNLRKLCLEMNTT 1053


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,154,894
Number of Sequences: 37544
Number of extensions: 527076
Number of successful extensions: 1565
Number of sequences better than 10.0: 62
Number of HSP's better than 10.0 without gapping: 1424
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1542
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 2051430072
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).