SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30026
         (796 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_04_1099 - 30886361-30886591,30886739-30886941,30887030-308875...    43   2e-04
01_01_1157 - 9203448-9203560,9204725-9204768,9205345-9205433,920...    38   0.009
12_01_0210 - 1593732-1593823,1594730-1594773,1594895-1594983,159...    36   0.049
11_01_0209 - 1642473-1642579,1642783-1642826,1642935-1643023,164...    35   0.065
09_06_0267 + 21938300-21938371,21938963-21939235,21940665-219412...    35   0.065
04_01_0056 - 579934-579993,580064-580243,580349-580507,581004-58...    34   0.11 
03_05_0434 + 24252994-24253449,24254791-24254877,24255450-242557...    34   0.11 
11_01_0207 - 1620192-1620280,1620408-1620451,1620703-1620791,162...    33   0.20 
07_03_0968 - 23027940-23028149,23028800-23029002,23029610-230301...    31   1.1  
05_07_0151 + 28038178-28038480,28038578-28038667,28039130-280391...    31   1.1  
12_01_0209 - 1583401-1583498,1583879-1583922,1584285-1584373,158...    31   1.4  
11_01_0211 - 1660249-1660352,1660504-1660547,1660893-1660934,166...    31   1.4  
01_01_1224 - 9888726-9888820,9889042-9889085,9889194-9889282,988...    30   2.4  
11_01_0208 - 1628020-1628117,1628282-1628325,1628790-1628878,162...    29   4.3  
05_07_0152 + 28044733-28045032,28045131-28045220,28045770-280458...    29   4.3  
02_03_0412 - 18749430-18749587,18749696-18749857,18750062-187501...    29   4.3  
10_02_0037 - 4441440-4443242                                           29   5.6  
09_02_0311 + 7164774-7166327                                           29   5.6  
12_02_0800 + 23299674-23299678,23299714-23299791,23299876-232999...    28   7.4  
05_07_0239 - 28599452-28599564,28599685-28599799,28600051-286001...    28   7.4  
05_04_0223 - 19192411-19192951,19193363-19193388                       28   7.4  
01_06_0518 + 29988613-29989193,29989596-29989622,29989759-299898...    28   7.4  
09_02_0157 + 5083771-5083996,5084007-5084326,5085958-5086392,508...    28   9.8  
01_01_0123 - 1142557-1142744,1143281-1143497                           28   9.8  

>04_04_1099 -
           30886361-30886591,30886739-30886941,30887030-30887555,
           30887751-30887988,30888592-30888695,30888784-30889059,
           30889216-30889218
          Length = 526

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 18/59 (30%), Positives = 34/59 (57%)
 Frame = +2

Query: 251 VPFFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           V   A  ++  ++S+V P+ + E +LT++Q  +I      G +  A+ WG+V D +GR+
Sbjct: 34  VGLIAEAMEMMLLSFVGPSVQLEWKLTSHQESMITSIVFVGMLIGAYTWGVVSDNYGRR 92


>01_01_1157 -
           9203448-9203560,9204725-9204768,9205345-9205433,
           9205565-9205609,9205805-9205912,9206003-9206088,
           9206492-9206579,9206725-9206910,9207181-9207256,
           9207332-9207381,9207715-9207777,9207882-9207962,
           9208028-9208130,9208246-9208348,9208489-9208549,
           9209059-9209154,9209185-9209225,9209848-9209922,
           9210412-9210562
          Length = 552

 Score = 37.9 bits (84), Expect = 0.009
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 2/58 (3%)
 Frame = +2

Query: 260 FASGVQNCIMSYV--LPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           F  G+ +C  S +  L  A+ E  +  Y AG +  ++M G   S+  WGIV D +GRK
Sbjct: 110 FTFGLNSCAGSVIRDLHIAKQEEDIGFY-AGFVGASYMFGRALSSVIWGIVADKYGRK 166


>12_01_0210 -
           1593732-1593823,1594730-1594773,1594895-1594983,
           1595076-1595120,1595457-1595564,1595647-1595732,
           1595872-1595959,1596159-1596335,1596531-1596606,
           1596709-1596758,1596834-1596896,1597152-1597254,
           1597337-1597439,1597559-1597619,1598119-1598159,
           1599790-1599961
          Length = 465

 Score = 35.5 bits (78), Expect = 0.049
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = +2

Query: 335 YQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           Y AG +  ++M G   +A FWG+V D  GRK
Sbjct: 86  YYAGFLGASYMVGRSFAAIFWGVVADRIGRK 116


>11_01_0209 -
           1642473-1642579,1642783-1642826,1642935-1643023,
           1643114-1643158,1643484-1643591,1643691-1643776,
           1643917-1644004,1644211-1644387,1644720-1644795,
           1644898-1644947,1645030-1645092,1645332-1645434,
           1645513-1645615,1645731-1645791,1646268-1646308,
           1646792-1646825
          Length = 424

 Score = 35.1 bits (77), Expect = 0.065
 Identities = 17/43 (39%), Positives = 24/43 (55%)
 Frame = +2

Query: 299 LPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           L  A+ E  +  Y AG +  ++M G   +A FWG+V D  GRK
Sbjct: 29  LQVAQTEEDIGNY-AGFLGASYMVGRSFAAIFWGVVADRIGRK 70


>09_06_0267 +
           21938300-21938371,21938963-21939235,21940665-21941202,
           21941288-21941490,21941603-21941827
          Length = 436

 Score = 35.1 bits (77), Expect = 0.065
 Identities = 15/55 (27%), Positives = 29/55 (52%)
 Frame = +2

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           +  ++  ++S+V  + + E +L+     LI      G +  A+ WGIV D +GR+
Sbjct: 60  SEAMEMMLLSFVGQSVQAEWELSAQAESLITSVVFVGMLVGAYSWGIVSDNYGRR 114


>04_01_0056 -
           579934-579993,580064-580243,580349-580507,581004-581050,
           583772-583895,584093-584956
          Length = 477

 Score = 34.3 bits (75), Expect = 0.11
 Identities = 18/51 (35%), Positives = 24/51 (47%)
 Frame = -3

Query: 518 VLAAAEVCSLERCFGLKLSLHPGATSSLGCSSCRRHRPLYPRRMHWRHHRS 366
           V A   V +++ C GL+    P  T    C   RR RP+ P    WRH+ S
Sbjct: 281 VAAMVSVLAVDSCIGLEFEPFPTRT----CFCARRRRPIPPDNDQWRHNVS 327


>03_05_0434 +
           24252994-24253449,24254791-24254877,24255450-24255748,
           24256146-24256383,24256907-24257441,24257527-24257729,
           24258311-24258520
          Length = 675

 Score = 34.3 bits (75), Expect = 0.11
 Identities = 20/82 (24%), Positives = 34/82 (41%)
 Frame = +2

Query: 284 IMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXXXXXXXXXXX 463
           ++S+V P  R E  ++     L++    +G +  A  WG V D +GR+            
Sbjct: 234 LLSFVGPLVREEWNISAENESLLSSVVFAGMLIGASGWGFVSDKYGRRICLLFSTLFASG 293

Query: 464 XXXXQSTVPDYRLLLQLEPSMG 529
                +  P+Y  LL L   +G
Sbjct: 294 MGFLSAFSPNYSCLLALRFLVG 315


>11_01_0207 -
           1620192-1620280,1620408-1620451,1620703-1620791,
           1620870-1620914,1621441-1621548,1621638-1621723,
           1622202-1622289,1622403-1622576,1623084-1623159,
           1623256-1623305,1623392-1623454,1623689-1623791,
           1623871-1623973,1624679-1624739,1624864-1624904,
           1625076-1625154
          Length = 432

 Score = 33.5 bits (73), Expect = 0.20
 Identities = 16/43 (37%), Positives = 24/43 (55%)
 Frame = +2

Query: 299 LPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           L  A+ E  +  Y AG +  ++M G   ++ FWG+V D  GRK
Sbjct: 44  LHVAKKEQDIGLY-AGFLGASYMIGRCFASLFWGVVADRIGRK 85


>07_03_0968 -
           23027940-23028149,23028800-23029002,23029610-23030138,
           23030342-23030579,23031121-23031168,23031199-23031494
          Length = 507

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 14/58 (24%), Positives = 31/58 (53%)
 Frame = +2

Query: 251 VPFFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGR 424
           V + A  ++  ++S+V P+ + E  ++    GL++    +G +  A   G++ D +GR
Sbjct: 41  VGWVAEAMEVMLLSFVGPSVKAEWGVSGAAEGLVSSVVFAGMLIGACLGGLISDRYGR 98


>05_07_0151 +
           28038178-28038480,28038578-28038667,28039130-28039189,
           28039274-28039339,28039562-28039627,28039719-28039794,
           28039972-28040036,28040115-28040192,28040362-28040442,
           28040526-28040610,28040702-28040748,28040969-28041028,
           28041179-28041244,28041327-28041386,28041524-28041638,
           28041733-28041845
          Length = 476

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 12/28 (42%), Positives = 17/28 (60%)
 Frame = +2

Query: 713 FTPWRLFLAWGSLPGFMRESGVLYLPES 796
           F PWRL    GS+P  +   G+ ++PES
Sbjct: 211 FVPWRLLAVIGSIPCTLLIPGLFFIPES 238


>12_01_0209 -
           1583401-1583498,1583879-1583922,1584285-1584373,
           1584911-1585018,1585158-1585243,1585385-1585472,
           1585970-1586140,1586379-1586454,1586534-1586583,
           1586692-1586754,1586839-1586892,1587038-1587140,
           1587265-1587367,1587479-1587569,1587629-1587669,
           1587801-1587879
          Length = 447

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 16/43 (37%), Positives = 23/43 (53%)
 Frame = +2

Query: 299 LPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           L  AR E  +  Y AG +  ++M G   ++  WG+V D  GRK
Sbjct: 54  LHVARTEEDIGFY-AGFLGASYMIGRGFASILWGMVADRIGRK 95


>11_01_0211 -
           1660249-1660352,1660504-1660547,1660893-1660934,
           1661010-1661098,1661181-1661225,1661501-1661545,
           1661574-1661681,1661765-1661850,1662253-1662340,
           1662884-1663084,1663491-1663566,1663652-1663701,
           1663783-1663845,1663924-1663977,1664093-1664195,
           1664328-1664430,1664516-1664576,1664872-1664912,
           1666605-1666761
          Length = 519

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 12/31 (38%), Positives = 17/31 (54%)
 Frame = +2

Query: 335 YQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           + AG +  +FM G   ++  WGI  D  GRK
Sbjct: 81  FYAGFVGASFMFGRCLTSTIWGIAADRIGRK 111


>01_01_1224 -
           9888726-9888820,9889042-9889085,9889194-9889282,
           9889390-9889434,9889849-9889956,9890042-9890127,
           9890324-9890411,9890669-9890872,9891251-9891326,
           9891429-9891478,9891753-9891815,9891942-9891995,
           9892079-9892181,9892266-9892368,9892563-9892623,
           9892746-9892786,9893183-9893348
          Length = 491

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 12/31 (38%), Positives = 16/31 (51%)
 Frame = +2

Query: 335 YQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           + AG +   +  G   SA  WGI  D +GRK
Sbjct: 84  FYAGFVGATYFLGRTISAVPWGIFADKYGRK 114


>11_01_0208 -
           1628020-1628117,1628282-1628325,1628790-1628878,
           1628986-1629030,1629397-1629504,1629650-1629735,
           1629870-1629957,1630275-1630445,1630718-1630793,
           1630877-1630926,1631035-1631097,1631201-1631254,
           1631398-1631500,1631626-1631728,1632038-1632098,
           1632186-1632226,1632375-1632453
          Length = 452

 Score = 29.1 bits (62), Expect = 4.3
 Identities = 11/31 (35%), Positives = 18/31 (58%)
 Frame = +2

Query: 335 YQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           + AG +  ++M G   ++  WG+V D  GRK
Sbjct: 55  FYAGFLGASYMIGRGFASILWGMVADRIGRK 85


>05_07_0152 +
           28044733-28045032,28045131-28045220,28045770-28045829,
           28045912-28045977,28046161-28046226,28046330-28046405,
           28046721-28046785,28046879-28046971,28047302-28047322,
           28047600-28047692,28047939-28047998,28048157-28048222,
           28048314-28048373,28048498-28048612,28048738-28048850
          Length = 447

 Score = 29.1 bits (62), Expect = 4.3
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +2

Query: 713 FTPWRLFLAWGSLPGFMRESGVLYLPES 796
           F PWRL    G LP  +   G+ ++PES
Sbjct: 210 FVPWRLLAVIGILPCTVLIPGLFFIPES 237


>02_03_0412 -
           18749430-18749587,18749696-18749857,18750062-18750194,
           18751640-18751744,18751818-18751935,18752232-18752320,
           18752407-18753660,18753785-18753831,18754285-18754339,
           18754783-18754884
          Length = 740

 Score = 29.1 bits (62), Expect = 4.3
 Identities = 14/52 (26%), Positives = 24/52 (46%), Gaps = 4/52 (7%)
 Frame = +2

Query: 110 NRPENRKPHSQRHGNLTRCHRRDGG----LRNRAGQSRVRPLQPECFRSVRV 253
           +R EN   ++Q  GN + CH  + G      N     +  P +PE   S+++
Sbjct: 75  SREENDDSYTQEVGNFSECHSSEHGNSGFSANNGTSGQATPQRPELMESLKI 126


>10_02_0037 - 4441440-4443242
          Length = 600

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 14/42 (33%), Positives = 25/42 (59%)
 Frame = +1

Query: 508 AARTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSFV 633
           AA  + GF  GG  TL+F+ +S++ G+K   +Y ++  +  V
Sbjct: 452 AASVVVGFSFGGLYTLLFSIVSEVFGLK---YYATLYNLGMV 490


>09_02_0311 + 7164774-7166327
          Length = 517

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 11/25 (44%), Positives = 17/25 (68%)
 Frame = +2

Query: 722 WRLFLAWGSLPGFMRESGVLYLPES 796
           WRL LA  ++P  +  +G L+LPE+
Sbjct: 201 WRLSLALAAVPAAVMTAGALFLPET 225


>12_02_0800 + 23299674-23299678,23299714-23299791,23299876-23299920,
            23300052-23300415,23300493-23300574,23300793-23300873,
            23300974-23302106,23302202-23302350,23302426-23302516,
            23303628-23305940
          Length = 1446

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = -2

Query: 792  SGKYSTPDSRMKPGRLPQARNNLHGVN 712
            SG    P S  KP  +PQ++ N HG N
Sbjct: 1250 SGTVPQPRSHWKPKTIPQSQGNSHGNN 1276


>05_07_0239 -
           28599452-28599564,28599685-28599799,28600051-28600116,
           28600270-28600329,28600571-28600617,28601118-28601202,
           28601554-28601646,28601727-28601791,28601942-28602017,
           28602110-28602175,28603082-28603141,28603400-28603489,
           28603594-28603893
          Length = 411

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +2

Query: 713 FTPWRLFLAWGSLPGFMRESGVLYLPES 796
           F PWR+    G LP  +   G+ ++PES
Sbjct: 188 FVPWRILSVLGILPCSILIPGLFFIPES 215


>05_04_0223 - 19192411-19192951,19193363-19193388
          Length = 188

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 14/42 (33%), Positives = 18/42 (42%)
 Frame = +1

Query: 85  ANPK*WFRKSPRKSEAPFTEAWQPH*MPPKRWRITKPRWTKQ 210
           A P  W   +   S A +T  WQ     P+  R   PRW +Q
Sbjct: 132 ARPTGWNAAAAPSSSASWTARWQGRRPAPRARRGGTPRWRRQ 173


>01_06_0518 +
           29988613-29989193,29989596-29989622,29989759-29989891,
           29990006-29990240,29990524-29990566,29990672-29990952,
           29991293-29991423,29991812-29991946
          Length = 521

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = +2

Query: 125 RKPHSQRHGNLTRCHRRDGGLRNRAGQ 205
           R P + RHG+ + CH    G +N  GQ
Sbjct: 183 RDPENGRHGSQSYCHHSPTGWKNFGGQ 209


>09_02_0157 +
           5083771-5083996,5084007-5084326,5085958-5086392,
           5087277-5087921
          Length = 541

 Score = 27.9 bits (59), Expect = 9.8
 Identities = 11/25 (44%), Positives = 17/25 (68%)
 Frame = +2

Query: 722 WRLFLAWGSLPGFMRESGVLYLPES 796
           WR+ LA  ++PG +   G L+LPE+
Sbjct: 231 WRVSLAVAAVPGGLLTLGALFLPET 255


>01_01_0123 - 1142557-1142744,1143281-1143497
          Length = 134

 Score = 27.9 bits (59), Expect = 9.8
 Identities = 9/21 (42%), Positives = 13/21 (61%)
 Frame = +1

Query: 328 DDIPSRIDQHGFYERWCRQCI 390
           DD  +R+D+     RWCR C+
Sbjct: 111 DDPYTRVDEKSALGRWCRNCV 131


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,494,741
Number of Sequences: 37544
Number of extensions: 585936
Number of successful extensions: 1538
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 1483
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1538
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2150667972
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).