SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30024
         (540 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_04_0433 - 22891261-22891509,22892181-22892301,22892405-228924...    91   5e-19
04_04_0211 - 23636377-23636532,23636624-23636805,23637853-236379...    87   8e-18
02_02_0470 - 10700092-10700505                                         30   1.4  
10_08_0951 - 21769342-21769752                                         29   3.1  
03_01_0014 + 113638-113754,113836-113950,114570-114835,115365-11...    28   5.5  
10_08_0026 - 14253680-14253894,14253981-14254109,14254704-142547...    27   7.2  
08_02_1540 + 27694565-27694579,27696364-27696447,27696599-276967...    27   9.6  
07_01_0555 - 4125087-4125578                                           27   9.6  

>02_04_0433 -
           22891261-22891509,22892181-22892301,22892405-22892496,
           22892692-22892755,22892855-22892920,22893102-22893193,
           22893991-22894050,22894181-22894270,22894484-22894613,
           22895066-22895157,22895299-22895373,22895663-22895754,
           22896496-22896586,22897541-22897574,22897745-22897791,
           22899110-22899209,22899300-22899436,22900837-22901015,
           22901146-22901188,22901264-22901297,22901839-22901948,
           22902043-22902224,22903062-22903168,22903266-22903480
          Length = 833

 Score = 91.1 bits (216), Expect = 5e-19
 Identities = 51/102 (50%), Positives = 69/102 (67%), Gaps = 5/102 (4%)
 Frame = +3

Query: 216 PSIQQACTQDPTQLKI----GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPL 383
           PS ++A   +PT+L+     GTV ILLAGR+ GKRVV +  L SGLLL+TGPF  N  P+
Sbjct: 61  PSTRKA---NPTKLRSTITPGTVLILLAGRYMGKRVVFLKQLKSGLLLITGPFKINGVPI 117

Query: 384 RRIPQRYVIGTSTRISLGNFKLPKHFNDDYFKKNKKC-VKRT 506
           RR+ Q YVI TST++ +   K+ K F+D YF ++KK   K+T
Sbjct: 118 RRVNQAYVIATSTKVDISGVKVDK-FDDKYFARDKKAKAKKT 158


>04_04_0211 -
           23636377-23636532,23636624-23636805,23637853-23637959,
           23637997-23638280
          Length = 242

 Score = 87.0 bits (206), Expect = 8e-18
 Identities = 43/76 (56%), Positives = 53/76 (69%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           GTV ILLAGR  GKRVV +  L SGLLLVTGPF  N  P+RR+ Q YVI TST++ +   
Sbjct: 101 GTVLILLAGRFMGKRVVFLKQLKSGLLLVTGPFKINGVPIRRVNQPYVIATSTKVDISGV 160

Query: 444 KLPKHFNDDYFKKNKK 491
            + K F+D YF ++KK
Sbjct: 161 NVEK-FDDKYFSRDKK 175


>02_02_0470 - 10700092-10700505
          Length = 137

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSG 338
           LK G   ILL GR+AG++ V+V +   G
Sbjct: 5   LKPGKAVILLQGRYAGRKAVIVRVFEEG 32


>10_08_0951 - 21769342-21769752
          Length = 136

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 13/28 (46%), Positives = 17/28 (60%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSG 338
           LK G   ILL GR AG++ V+V +   G
Sbjct: 5   LKPGKAVILLQGRFAGRKAVIVRVFEEG 32


>03_01_0014 +
           113638-113754,113836-113950,114570-114835,115365-115575,
           115915-115979,118723-118930,119457-119566,119663-119913,
           120250-120356,120442-120509,120624-120701,121070-121198,
           121341-121481,122297-122344,122648-122743,124071-124183,
           124441-124591,124745-124818,124913-125072,125356-125454,
           125532-125618,125761-125907
          Length = 946

 Score = 27.9 bits (59), Expect = 5.5
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%)
 Frame = +3

Query: 174 LLPHSGENPCFIWWPSIQQACTQDPTQLKIGTVC-ILLAGRH 296
           +LP S E P    W +   ACT DP   + G  C  +L GR+
Sbjct: 51  VLPESYEPPADEPWTTGIFACTDDPQTCRTGLFCPCVLFGRN 92


>10_08_0026 -
           14253680-14253894,14253981-14254109,14254704-14254769,
           14254887-14255133
          Length = 218

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 19/75 (25%), Positives = 34/75 (45%)
 Frame = +2

Query: 182 PLRRKSVLHLVAVHSASMYAGSDPTEDRNCLHSPRW*TCRQEGCTCWNSAQRSAFSYWTF 361
           PL   +   L+AV +A++ AG+      +  H  R     Q G    ++ +    + W+ 
Sbjct: 9   PLLLVAAAALIAVVTATVAAGAGEGPACDTAHCGRGQCVEQPGPLGLDTFRCDCDAGWSN 68

Query: 362 CFQFVPATPYSSALC 406
            F F+PA+P +   C
Sbjct: 69  MFAFLPASPCTIPKC 83


>08_02_1540 +
           27694565-27694579,27696364-27696447,27696599-27696731,
           27696840-27696951,27697530-27697629,27697810-27697937,
           27698046-27698115,27698548-27698636,27698719-27698764,
           27698854-27698924,27699002-27699075,27699341-27699433,
           27699539-27699572,27699704-27699789,27702147-27702223,
           27702445-27702533,27702630-27702813,27703068-27703249,
           27703962-27704064,27704159-27704490,27704577-27705018,
           27705749-27705846,27706988-27707081,27707666-27707787,
           27708025-27708078,27708185-27708304,27708595-27708799,
           27708889-27709059,27709155-27709310,27709375-27709431,
           27709474-27709580,27709708-27709798,27709931-27710072,
           27710149-27710305,27710400-27710516,27710596-27710722,
           27710844-27711066,27711460-27711466,27711656-27711788
          Length = 1574

 Score = 27.1 bits (57), Expect = 9.6
 Identities = 11/35 (31%), Positives = 20/35 (57%), Gaps = 2/35 (5%)
 Frame = +3

Query: 120 WR*EEWGNQNSTPQT*EV--LLPHSGENPCFIWWP 218
           W+  E   Q+++P   ++  L  H+G+  C +WWP
Sbjct: 86  WKIPELHGQSNSPPLEQLFTLDEHTGKIRCVLWWP 120


>07_01_0555 - 4125087-4125578
          Length = 163

 Score = 27.1 bits (57), Expect = 9.6
 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 2/41 (4%)
 Frame = +3

Query: 249 TQLKIGTVCILLAGRHAGKRVVLVGILPSGLL--LVTGPFA 365
           T L + T    LA RH+ K VVL+ ++P  L+  ++T  F+
Sbjct: 123 TGLILATTATWLARRHSAKVVVLLALVPQVLVAGVITSTFS 163


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,306,413
Number of Sequences: 37544
Number of extensions: 331075
Number of successful extensions: 787
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 768
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 787
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1198356516
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).