SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30023
         (770 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_06_0233 + 26599068-26599466,26601214-26601829,26601871-266019...    90   2e-18
02_05_0538 + 29841801-29842280,29842559-29842930,29843013-29843309     68   7e-12
05_03_0396 - 13477465-13477761,13477970-13478341,13478414-13478887     65   5e-11
11_06_0633 + 25681756-25682061,25682961-25683329,25683419-25683733     64   2e-10
01_05_0099 - 18098169-18098390,18098878-18098972,18099063-180991...    42   4e-04
03_05_1041 - 29884975-29885107,29885485-29885552,29885652-298858...    41   0.001
03_02_0646 + 10141967-10142476,10143721-10144254                       40   0.002
04_04_0048 + 22351788-22352177,22353175-22353711                       38   0.012
01_07_0386 + 43218686-43218745,43218972-43219190,43219307-432193...    38   0.012
05_07_0283 - 28937027-28937110,28937211-28937549,28937641-289377...    37   0.016
01_01_0282 - 2349336-2349583,2349719-2349786,2349880-2349950,235...    37   0.016
11_08_0097 + 28330565-28330645,28330768-28330986,28331066-283311...    36   0.047
02_02_0134 + 7082462-7082627,7084199-7084325,7084404-7084611,708...    36   0.047
03_02_0489 + 8836306-8836500,8836906-8837082,8837175-8837321,883...    34   0.14 
12_02_0618 - 21262021-21262117,21262429-21262466,21262933-212629...    33   0.19 
09_04_0437 - 17587944-17588909                                         33   0.19 
06_03_0677 - 23440273-23440749,23440824-23440985,23442007-23442627     33   0.33 
09_04_0628 + 19093665-19094033,19094408-19094722                       32   0.44 
08_02_1016 - 23606089-23607072                                         32   0.44 
01_01_1139 - 9024609-9024708,9024832-9024910,9025083-9025252,902...    31   1.0  
01_05_0410 + 21914995-21915168,21915268-21915353,21915446-219156...    31   1.3  
01_06_0447 + 29452194-29452361,29453232-29453317,29453403-294536...    30   1.8  
01_07_0083 + 40970890-40971015,40971886-40971994,40972679-409727...    30   2.4  
05_01_0505 + 4207841-4208455,4209982-4210143,4210247-4210717           29   3.1  
11_04_0086 + 13362788-13362937,13363887-13363970,13364233-133642...    28   7.2  
07_03_0117 + 13589997-13590998                                         28   7.2  
03_01_0644 - 4719954-4720022,4720445-4720912,4721009-4721312,472...    28   7.2  
11_01_0445 - 3455449-3456096,3456348-3457958                           28   9.5  

>05_06_0233 +
           26599068-26599466,26601214-26601829,26601871-26601917,
           26602101-26602268
          Length = 409

 Score = 89.8 bits (213), Expect = 2e-18
 Identities = 41/73 (56%), Positives = 51/73 (69%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           +ISYP DTVRRRMMMQSG      +Y +T+ CW  I K EG   F++GA SN+ R TG A
Sbjct: 266 LISYPLDTVRRRMMMQSGMDVQ--MYSSTLDCWRKIYKVEGIKSFYRGALSNMFRSTGAA 323

Query: 181 FVLVLYDEIKKVL 219
            +LVLYDE+KK +
Sbjct: 324 AILVLYDEVKKFM 336


>02_05_0538 + 29841801-29842280,29842559-29842930,29843013-29843309
          Length = 382

 Score = 68.1 bits (159), Expect = 7e-12
 Identities = 34/70 (48%), Positives = 46/70 (65%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + SYP DTVRRRMMM SG A   + YK+++  ++ I K EG    FKGA +N+LR   GA
Sbjct: 303 LASYPIDTVRRRMMMTSGEA---VKYKSSMDAFSQILKNEGAKSLFKGAGANILRAIAGA 359

Query: 181 FVLVLYDEIK 210
            VL  YD+++
Sbjct: 360 GVLSGYDQLQ 369


>05_03_0396 - 13477465-13477761,13477970-13478341,13478414-13478887
          Length = 380

 Score = 65.3 bits (152), Expect = 5e-11
 Identities = 33/73 (45%), Positives = 45/73 (61%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + SYP DTVRRRMMM SG A   + Y +++  +  I   EG    FKGA +N+LR   GA
Sbjct: 301 LASYPIDTVRRRMMMTSGEA---VKYNSSLDAFKQIVAKEGAKSLFKGAGANILRAVAGA 357

Query: 181 FVLVLYDEIKKVL 219
            VL  YD+++ V+
Sbjct: 358 GVLAGYDKLQVVV 370


>11_06_0633 + 25681756-25682061,25682961-25683329,25683419-25683733
          Length = 329

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 31/69 (44%), Positives = 42/69 (60%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFV 186
           +YPFDT+RRRMM+ SG+    + YKN  H    I  TEG    F+G  +N+L G  GA V
Sbjct: 246 AYPFDTLRRRMMLTSGQP---LKYKNAFHAAKQIVSTEGFFTLFRGVGANILSGMAGAGV 302

Query: 187 LVLYDEIKK 213
           L  YD++ +
Sbjct: 303 LAGYDQLHR 311


>01_05_0099 -
           18098169-18098390,18098878-18098972,18099063-18099131,
           18099277-18099352,18101412-18101524,18104137-18104185,
           18104540-18104572,18105446-18105552,18106892-18106990,
           18107122-18107203
          Length = 314

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 1/74 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           II+YP + VR ++  Q       + Y   I C   + + EG   F++G  +N+LR T  A
Sbjct: 235 IITYPHEVVRSKLQEQGRARHGAVHYTGVIDCIKQVYQKEGIPGFYRGCATNLLRTTPNA 294

Query: 181 FV-LVLYDEIKKVL 219
            +    Y+ I +++
Sbjct: 295 VITFTSYEMINRLM 308


>03_05_1041 -
           29884975-29885107,29885485-29885552,29885652-29885816,
           29886262-29886372,29886999-29887072,29887387-29887480,
           29887750-29887849,29888075-29888151,29888856-29888935,
           29889025-29889157
          Length = 344

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDIL-YKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT 171
           +P D VR R  +  GR   D+  Y+NT H   TIA++EG    + G +  VL  T
Sbjct: 34  HPLDVVRTRFQVSGGRGCYDLPPYRNTAHAVYTIARSEGLRGLYAGFYPAVLGST 88


>03_02_0646 + 10141967-10142476,10143721-10144254
          Length = 347

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 25/70 (35%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           I + PFD V+ R+M Q GR   DI YK  +H   TI   EG    +KG    ++R   G 
Sbjct: 266 ICTGPFDVVKTRLMAQ-GRT-GDIKYKGMVHAIRTIYTEEGLRALWKGLLPRLMRIPPGQ 323

Query: 178 AFVLVLYDEI 207
           A +  + D++
Sbjct: 324 AIMWAVADQV 333



 Score = 35.5 bits (78), Expect = 0.047
 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 1/53 (1%)
 Frame = +1

Query: 25  VRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGA 180
           V+ R+  Q G +   + YK  IHC  TI   EG    + GA   V+R GT  A
Sbjct: 172 VKIRLQQQKGLSPDLLRYKGPIHCARTIVTEEGLFGLWAGALPTVMRNGTNQA 224



 Score = 29.1 bits (62), Expect = 4.1
 Identities = 12/44 (27%), Positives = 21/44 (47%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG 144
           P D ++ R+ +    A     Y+   HC  T+ ++EG    +KG
Sbjct: 59  PIDVIKTRLQLDRSGA-----YRGIAHCGTTVVRSEGVRALWKG 97


>04_04_0048 + 22351788-22352177,22353175-22353711
          Length = 308

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAF 183
           +S P D ++ RMM Q   AK  +LY+N+  C     K EG +  +KG      R     F
Sbjct: 233 LSCPADVIKTRMMNQGKDAK--VLYRNSYDCLVKTVKHEGLTALWKGFLPTWARLGPWQF 290

Query: 184 VL-VLYDEIKK 213
           V  V Y+++++
Sbjct: 291 VFWVSYEKLRQ 301


>01_07_0386 +
           43218686-43218745,43218972-43219190,43219307-43219391,
           43219583-43219713,43219802-43219900,43219984-43220088,
           43220190-43220264,43222006-43222092,43222129-43222173
          Length = 301

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 20/54 (37%), Positives = 27/54 (50%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           I  P D V+ RMM        D  YK+T+ C+A   K +G   F+KG  +N  R
Sbjct: 227 IGSPVDVVKSRMM-------GDATYKSTLDCFAKTLKNDGLPAFYKGFIANFCR 273


>05_07_0283 -
           28937027-28937110,28937211-28937549,28937641-28937754,
           28937843-28937955,28939050-28939087,28939315-28939478,
           28939746-28939794,28940986-28941152
          Length = 355

 Score = 37.1 bits (82), Expect = 0.016
 Identities = 23/82 (28%), Positives = 36/82 (43%), Gaps = 10/82 (12%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMM---------QSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSN 156
           ++YP D +RRRM M          +G  K  + Y   I  +    + EG    +KG   N
Sbjct: 266 VAYPLDVIRRRMQMVGWNNAASIVTGEGKEALQYNGMIDAFRKTVRYEGVGALYKGLVPN 325

Query: 157 VLRGTGG-AFVLVLYDEIKKVL 219
            ++     A   V Y+ ++KVL
Sbjct: 326 SVKVVPSIAIAFVTYEFVQKVL 347


>01_01_0282 -
           2349336-2349583,2349719-2349786,2349880-2349950,
           2350022-2350123,2350309-2350449,2350540-2350716,
           2352228-2352338
          Length = 305

 Score = 37.1 bits (82), Expect = 0.016
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGA 180
           ++YP D VR R+  Q    K+   YK   H  +TI + EG    +KG  + +L  G   A
Sbjct: 129 VTYPLDVVRTRLATQ----KTTRYYKGIFHAVSTICRDEGVKGLYKGLGATLLGVGPSIA 184

Query: 181 FVLVLYDEIK 210
               +Y+ ++
Sbjct: 185 ISFTVYESLR 194



 Score = 32.3 bits (70), Expect = 0.44
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 3/74 (4%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG---AFSNVLRGTGG 177
           ++P D V+RRM +Q     S +   +       I + EG   F++G    +  V+   G 
Sbjct: 225 TFPLDLVKRRMQLQGAAGTSSVCKSSITGTIRQIFQKEGLRGFYRGIVPEYLKVVPSVGI 284

Query: 178 AFVLVLYDEIKKVL 219
           AF  + Y+ +K +L
Sbjct: 285 AF--MTYETLKSLL 296


>11_08_0097 +
           28330565-28330645,28330768-28330986,28331066-28331144,
           28331222-28331355,28331447-28331545,28331638-28331742,
           28332377-28332451,28333671-28333757,28333854-28333889
          Length = 304

 Score = 35.5 bits (78), Expect = 0.047
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 1/72 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGA 180
           +  P D V+ RMM        D  Y +TI C+    K +G   F+KG   N  R G+   
Sbjct: 233 VGSPVDVVKSRMM-------GDSAYTSTIDCFVKTLKNDGPLAFYKGFLPNFARLGSWNV 285

Query: 181 FVLVLYDEIKKV 216
            + +  ++++K+
Sbjct: 286 IMFLTLEQVQKL 297



 Score = 31.5 bits (68), Expect = 0.77
 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 2/74 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSG-RAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRG-TG 174
           + + P DT + R+ +Q    A +   Y+  +   ATIA+ EG +  +KG    + R    
Sbjct: 28  VCTIPLDTAKVRLQLQKNVAADAAPKYRGLLGTAATIAREEGAAALWKGIVPGLHRQCIY 87

Query: 175 GAFVLVLYDEIKKV 216
           G   + LY+ ++ V
Sbjct: 88  GGLRIGLYEPVRTV 101


>02_02_0134 +
           7082462-7082627,7084199-7084325,7084404-7084611,
           7084864-7084990,7085071-7085255,7085332-7085454,
           7085777-7085836,7085980-7086117
          Length = 377

 Score = 35.5 bits (78), Expect = 0.047
 Identities = 20/54 (37%), Positives = 28/54 (51%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           I+YP D VRR+M +Q+  + +    K T    A IAK +G    F G   N L+
Sbjct: 259 ITYPLDVVRRQMQVQAFSSSNLEKGKGTFGSIAMIAKHQGWRQLFSGLSINYLK 312


>03_02_0489 +
           8836306-8836500,8836906-8837082,8837175-8837321,
           8837636-8837737,8837824-8837894,8837992-8838059,
           8838595-8838836
          Length = 333

 Score = 33.9 bits (74), Expect = 0.14
 Identities = 16/73 (21%), Positives = 32/73 (43%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG-A 180
           I++P D VRRRM ++    ++ +        +  I +TE     ++G      +      
Sbjct: 254 ITFPLDLVRRRMQLEGAAGRARVYQTGLFGTFGHIVRTESLRGLYRGILPEYCKVVPSVG 313

Query: 181 FVLVLYDEIKKVL 219
            V + Y+ +K +L
Sbjct: 314 IVFMTYETLKSIL 326


>12_02_0618 -
           21262021-21262117,21262429-21262466,21262933-21262986,
           21263274-21263438,21263523-21263759,21263857-21263918,
           21264543-21264656,21264816-21264942,21266200-21266218,
           21266338-21266428,21266932-21267094,21267182-21267330,
           21268147-21268287,21268368-21268533,21268568-21268631,
           21268729-21269084,21269759-21269977,21270328-21270433,
           21270713-21270942
          Length = 865

 Score = 33.5 bits (73), Expect = 0.19
 Identities = 14/49 (28%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +1

Query: 73  LYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVLVLYDEIKKV 216
           +Y+N  HC   +  TEG +  +KG F+   R G   A   V+ ++++++
Sbjct: 811 VYRNGFHCGYQVVVTEGVTSLYKGGFATFARLGPQTAITFVVCEKLREL 859


>09_04_0437 - 17587944-17588909
          Length = 321

 Score = 33.5 bits (73), Expect = 0.19
 Identities = 20/70 (28%), Positives = 32/70 (45%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFV 186
           S P D V+ R+M     A +   Y   + C     ++EG    +KG    V R   G F 
Sbjct: 245 STPVDVVKTRVMNMKVVAGAPPPYSGALDCLIKTVRSEGAMALYKGFVPTVTR--QGPFT 302

Query: 187 LVLYDEIKKV 216
           +VL+  +++V
Sbjct: 303 IVLFVTLEQV 312


>06_03_0677 - 23440273-23440749,23440824-23440985,23442007-23442627
          Length = 419

 Score = 32.7 bits (71), Expect = 0.33
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 1/72 (1%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFV 186
           ++P +  R++M  Q G      +YKN  H    I + EG    +KG   + ++    A +
Sbjct: 342 TFPLEVARKQM--QVGAVGGRQVYKNVFHALYCIMENEGIGGLYKGLGPSCIKLMPAAGI 399

Query: 187 -LVLYDEIKKVL 219
             + Y+  KK+L
Sbjct: 400 SFMCYEACKKIL 411



 Score = 32.3 bits (70), Expect = 0.44
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 2/71 (2%)
 Frame = +1

Query: 13  PFDTVRRRMMMQS-GRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFV 186
           P +T+R  +M+ S G + +++        + +I KTEG +  F+G F NV+R     A  
Sbjct: 156 PLETIRTHLMVGSNGDSMTEV--------FQSIMKTEGWTGLFRGNFVNVIRVAPSKAIE 207

Query: 187 LVLYDEIKKVL 219
           L  +D  KK L
Sbjct: 208 LFAFDTAKKFL 218


>09_04_0628 + 19093665-19094033,19094408-19094722
          Length = 227

 Score = 32.3 bits (70), Expect = 0.44
 Identities = 14/29 (48%), Positives = 18/29 (62%)
 Frame = -3

Query: 87 GVLVQDIALGTTRLHHHAPTDCVEGIGDD 1
          G  V+ +ALG   LHHHAP D ++  G D
Sbjct: 8  GGAVEGLALGIAPLHHHAPCDDLKDDGGD 36


>08_02_1016 - 23606089-23607072
          Length = 327

 Score = 32.3 bits (70), Expect = 0.44
 Identities = 20/70 (28%), Positives = 31/70 (44%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFV 186
           S P D V+ R+M       +   Y   I C     ++EG    +KG    V R   G F 
Sbjct: 251 SNPVDVVKTRVMNMKVAPGAPPPYSGAIDCALKTVRSEGVMALYKGFIPTVSR--QGPFT 308

Query: 187 LVLYDEIKKV 216
           +VL+  +++V
Sbjct: 309 VVLFVTLEQV 318


>01_01_1139 -
           9024609-9024708,9024832-9024910,9025083-9025252,
           9025339-9025451,9025518-9025586,9025867-9025944,
           9026022-9026084,9026590-9026670,9027166-9027222,
           9027352-9027705
          Length = 387

 Score = 31.1 bits (67), Expect = 1.0
 Identities = 18/74 (24%), Positives = 34/74 (45%), Gaps = 1/74 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           ++ YP DTVRR+M M+         Y   +     I + +G    ++G   N L+    +
Sbjct: 301 LMCYPLDTVRRQMQMKGSP------YNTVLDAIPGIVERDGLIGLYRGFVPNALKNLPNS 354

Query: 181 FV-LVLYDEIKKVL 219
            + L  +D +K ++
Sbjct: 355 SIKLTAFDTVKTLI 368


>01_05_0410 +
           21914995-21915168,21915268-21915353,21915446-21915656,
           21915869-21915998,21916740-21916924,21917014-21917145,
           21917329-21917433
          Length = 340

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 21/76 (27%), Positives = 34/76 (44%), Gaps = 4/76 (5%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGR---AKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTG 174
           ++YP D VRR+M +Q+ +   A      + T    A I + +G    F G   N ++   
Sbjct: 250 LTYPLDVVRRQMQVQNKQPHNANDAFRIRGTFQGLALIIRCQGWRQLFAGLSLNYVKVVP 309

Query: 175 G-AFVLVLYDEIKKVL 219
             A     YD +K +L
Sbjct: 310 SVAIGFTTYDMMKNLL 325


>01_06_0447 +
           29452194-29452361,29453232-29453317,29453403-29453610,
           29454252-29454381,29454561-29454745,29454858-29454989,
           29455747-29455851
          Length = 337

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 21/76 (27%), Positives = 33/76 (43%), Gaps = 4/76 (5%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDI---LYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTG 174
           ++YP D VRR+M +QS +          + T      I +T+G    F G   N ++   
Sbjct: 247 LTYPLDVVRRQMQVQSQQYHDKFGGPQIRGTFQGLMIIKQTQGWRQLFAGLSLNYIKVVP 306

Query: 175 G-AFVLVLYDEIKKVL 219
             A     YD +K +L
Sbjct: 307 SVAIGFTAYDTMKSLL 322


>01_07_0083 +
           40970890-40971015,40971886-40971994,40972679-40972790,
           40972944-40973100,40973609-40973761,40974143-40974292,
           40974803-40974999,40975446-40975473
          Length = 343

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 19/74 (25%), Positives = 30/74 (40%), Gaps = 8/74 (10%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQS-------GRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRG 168
           +P D V++R  ++        G       YK   H    I   EG    +KG F ++++ 
Sbjct: 259 HPLDVVKKRFQIEGLKRHPRYGARIESSTYKGMYHALKEIVAKEGFGGLYKGLFPSLVKS 318

Query: 169 T-GGAFVLVLYDEI 207
              GA   V Y+ I
Sbjct: 319 APAGAVTFVAYEYI 332


>05_01_0505 + 4207841-4208455,4209982-4210143,4210247-4210717
          Length = 415

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 1/70 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           P +T+R  +M+ S          +T   + +I K EG +  F+G F NV+R     A  L
Sbjct: 154 PLETIRTHLMVGSNG-------NSTAEVFQSIMKHEGWTGLFRGNFVNVIRVAPSKAIEL 206

Query: 190 VLYDEIKKVL 219
             +D   K L
Sbjct: 207 FAFDTANKFL 216


>11_04_0086 +
           13362788-13362937,13363887-13363970,13364233-13364294,
           13365146-13365507,13365928-13366142,13366236-13366292
          Length = 309

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 22/69 (31%), Positives = 27/69 (39%), Gaps = 2/69 (2%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGR-AKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTG-G 177
           +  P D    RM   S   A     YKN  H    IA  EG    +KGA   V+R     
Sbjct: 133 VGSPADLALIRMQADSTLPAAQSRNYKNAFHALYRIAADEGVLALWKGAGPTVVRAMSLN 192

Query: 178 AFVLVLYDE 204
             +L  YD+
Sbjct: 193 MGMLASYDQ 201


>07_03_0117 + 13589997-13590998
          Length = 333

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 1/72 (1%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG-AFSNVLRGTGGAF 183
           +YP D VRR++ +  G          T+  +  I + +G    + G   + V +    A 
Sbjct: 256 TYPLDVVRRQIQLGGGGG-------GTLQAFRAIVRAQGARQLYAGLGITYVKKVPSTAV 308

Query: 184 VLVLYDEIKKVL 219
            LV YD +K +L
Sbjct: 309 GLVAYDYMKSLL 320


>03_01_0644 -
           4719954-4720022,4720445-4720912,4721009-4721312,
           4722321-4722745
          Length = 421

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 20/71 (28%), Positives = 32/71 (45%), Gaps = 1/71 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVL-RGTGG 177
           I+  P DT+R RM+   G A   +     I     + +TEG    +KG   +++     G
Sbjct: 236 ILCIPMDTIRTRMVAPGGEALGGV-----IGVARHMIQTEGFFSLYKGLVPSLISMAPSG 290

Query: 178 AFVLVLYDEIK 210
           A    +YD +K
Sbjct: 291 AVFYGVYDILK 301


>11_01_0445 - 3455449-3456096,3456348-3457958
          Length = 752

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 10/18 (55%), Positives = 12/18 (66%)
 Frame = +2

Query: 695 GSEFDIIM*WIFDFCTHY 748
           G  FDIIM W+F FC  +
Sbjct: 390 GCNFDIIMTWVFMFCVMF 407


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,332,616
Number of Sequences: 37544
Number of extensions: 330927
Number of successful extensions: 654
Number of sequences better than 10.0: 28
Number of HSP's better than 10.0 without gapping: 620
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 649
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 2075009728
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).