SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30022
         (834 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_05_0717 + 31190626-31191234,31191954-31192394,31192699-311928...    29   6.0  
11_06_0133 + 20443871-20445122,20445642-20446625,20446776-20447155     28   8.0  
01_01_0332 - 2687623-2688032,2688195-2689921,2690017-2690942           28   8.0  

>02_05_0717 +
           31190626-31191234,31191954-31192394,31192699-31192802,
           31193000-31194384,31194508-31194548,31195065-31195133,
           31195335-31195435,31195747-31195825,31195939-31196037,
           31196119-31196187,31197609-31197658,31197749-31197925,
           31198045-31198152,31198224-31198290
          Length = 1132

 Score = 28.7 bits (61), Expect = 6.0
 Identities = 14/36 (38%), Positives = 21/36 (58%)
 Frame = +2

Query: 602 NEEKTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEV 709
           NE ++   +   K +E+  + I +SST  SPS PEV
Sbjct: 501 NESRSTDDIAAAKNKERSSVTINSSSTSPSPSSPEV 536


>11_06_0133 + 20443871-20445122,20445642-20446625,20446776-20447155
          Length = 871

 Score = 28.3 bits (60), Expect = 8.0
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = -1

Query: 681 VLEFGIIISGCSSGFLTSTYTSVFSSFCGWIGIM 580
           +L F  ++SG S G L S  TS+   +C W G++
Sbjct: 38  LLSFKSMLSGPSDGLLASWNTSI--HYCDWTGVV 69


>01_01_0332 - 2687623-2688032,2688195-2689921,2690017-2690942
          Length = 1020

 Score = 28.3 bits (60), Expect = 8.0
 Identities = 14/26 (53%), Positives = 17/26 (65%)
 Frame = -1

Query: 660 ISGCSSGFLTSTYTSVFSSFCGWIGI 583
           +SG SS  L S  TS  +SFCGW G+
Sbjct: 37  LSGSSSSALASWNTS--ASFCGWEGV 60


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,652,665
Number of Sequences: 37544
Number of extensions: 374811
Number of successful extensions: 1554
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 1456
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1552
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2303447664
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).