SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30019
         (719 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_02_1167 + 26647293-26648356,26648493-26648577,26649129-266491...    31   0.92 
01_01_1044 + 8231933-8231941,8232091-8232166,8232423-8232871           31   0.92 
12_02_1166 + 26643045-26644078,26644238-26644322,26646800-26646937     31   1.2  
04_04_1212 - 31786063-31786195,31786275-31786398,31786486-317865...    30   1.6  
08_01_0364 - 3218309-3218414,3218882-3218941,3219898-3219969,322...    29   2.8  
04_03_0800 - 19820886-19821421,19822476-19822563,19822871-19822888     29   3.7  
06_03_1282 - 28946363-28946533,28947234-28947272,28947399-289475...    29   4.9  
01_05_0214 - 19362812-19363477                                         29   4.9  
10_08_0425 - 17806117-17806401,17806862-17806984,17807076-178072...    28   6.5  
08_02_1098 - 24291138-24291851,24292607-24292861                       28   8.6  
07_03_0234 + 15561003-15561482,15562495-15562590,15562663-15562758     28   8.6  
06_03_0868 - 25544933-25544938,25544939-25545142,25545494-255457...    28   8.6  
02_04_0413 + 22681957-22682035,22682253-22682788                       28   8.6  
01_05_0624 + 23772613-23774671,23774737-23775596                       28   8.6  

>12_02_1167 +
           26647293-26648356,26648493-26648577,26649129-26649191,
           26649381-26649443,26649987-26650070,26650229-26650783
          Length = 637

 Score = 31.1 bits (67), Expect = 0.92
 Identities = 21/50 (42%), Positives = 24/50 (48%)
 Frame = -1

Query: 719 AVGGPVLWNEPRLKPAVVRSAGVLQQF**SPSASWKEYEPFTTSPXAYLL 570
           A GG   W EP    AV R+AGV   +   P   WK  +P   SP  YLL
Sbjct: 291 AGGGLEYWLEPAELAAVRRNAGVADPY-WVPPPGWKPGDP--VSPEGYLL 337


>01_01_1044 + 8231933-8231941,8232091-8232166,8232423-8232871
          Length = 177

 Score = 31.1 bits (67), Expect = 0.92
 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 1/29 (3%)
 Frame = +3

Query: 153 CQARCCYPCSLP-RGPCSVPGRPSCLPRG 236
           C   C  PC LP   PC +P  P C PRG
Sbjct: 130 CPPPCPPPCPLPCPPPCPLPCPPPCPPRG 158



 Score = 30.7 bits (66), Expect = 1.2
 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 8/46 (17%)
 Frame = +3

Query: 147 PRCQARCCYPCSLP------RGPCSVPGRPSC-LP-RGPCSVPGAP 260
           P C   C  PCS P      RG C  P  P C LP   PC +P  P
Sbjct: 107 PGCPCSCSTPCSFPPIGCHDRGICPPPCPPPCPLPCPPPCPLPCPP 152


>12_02_1166 + 26643045-26644078,26644238-26644322,26646800-26646937
          Length = 418

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 21/50 (42%), Positives = 23/50 (46%)
 Frame = -1

Query: 719 AVGGPVLWNEPRLKPAVVRSAGVLQQF**SPSASWKEYEPFTTSPXAYLL 570
           A GG   W EP    AV R AGV   +   P   WK  +P   SP  YLL
Sbjct: 281 AGGGLEYWLEPAELAAVRRKAGVADPY-WVPPPGWKPGDP--VSPEGYLL 327


>04_04_1212 -
           31786063-31786195,31786275-31786398,31786486-31786597,
           31786691-31786822,31786929-31787111,31787351-31787479,
           31787618-31787788,31788142-31788244,31788628-31788737,
           31789158-31789265,31789337-31789512,31790082-31790352,
           31790524-31790738,31791042-31792574,31792665-31792728,
           31793171-31793251
          Length = 1214

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 9/29 (31%), Positives = 18/29 (62%)
 Frame = -2

Query: 673 LWFVQPVYFNSSDRARQLRGKSMNPLLHH 587
           LW+++P  + + DR +    +S  PL+H+
Sbjct: 495 LWYIEPHTYKAGDRVKLFYNRSSRPLMHN 523


>08_01_0364 - 3218309-3218414,3218882-3218941,3219898-3219969,
            3220080-3223195,3223303-3223561,3223665-3223951,
            3224029-3224364,3224463-3224604,3224690-3224910,
            3224990-3225151,3225242-3225400,3225488-3225787,
            3226306-3226569,3227370-3227453
          Length = 1855

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 15/42 (35%), Positives = 18/42 (42%)
 Frame = +3

Query: 186  PRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVS 311
            P  P   P  PS  P  P   PG+P    TSP    ++ S S
Sbjct: 1566 PTSPSYSPASPSYSPTSPSYTPGSPTYSPTSPSYSPTSPSYS 1607


>04_03_0800 - 19820886-19821421,19822476-19822563,19822871-19822888
          Length = 213

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 1/44 (2%)
 Frame = +3

Query: 120 HCAP*PASAPRCQARC-CYPCSLPRGPCSVPGRPSCLPRGPCSV 248
           HC P P   P     C C  C    G C+ P  P C   G CS+
Sbjct: 120 HCCPEPPPPPPKPKPCECTYCGGHGGGCNKPAVPPC--AGGCSI 161


>06_03_1282 -
           28946363-28946533,28947234-28947272,28947399-28947566,
           28947605-28947697,28948135-28948215,28948409-28948499,
           28948657-28948728,28948803-28948903,28949283-28949381,
           28949631-28949954
          Length = 412

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%)
 Frame = +1

Query: 25  IVVLCALV-AVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQ 144
           IV+L A V AV     L  P HY+P   VSS S      P+
Sbjct: 15  IVILIAFVCAVGIGAYLYTPQHYTPCYLVSSNSCSSRPPPE 55


>01_05_0214 - 19362812-19363477
          Length = 221

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 17/49 (34%), Positives = 21/49 (42%)
 Frame = +3

Query: 177 CSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSSQNI 323
           C LP  P   P +PS  P  P   P +P    TSPL    A+  +   I
Sbjct: 29  CPLPLSPPYSPAQPSPPPTSP---PASPTLLPTSPLSDDHADHTTDSLI 74


>10_08_0425 -
           17806117-17806401,17806862-17806984,17807076-17807222,
           17807307-17807450,17808557-17808668,17808762-17808898,
           17809016-17809156,17810921-17811004,17811275-17811742,
           17811858-17811936,17812494-17812506,17813884-17814460,
           17814502-17814774,17814899-17815045,17815354-17815413,
           17816124-17816510
          Length = 1058

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 14/39 (35%), Positives = 20/39 (51%)
 Frame = +3

Query: 201 SVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSSQ 317
           SVPG+PS +   P S+ G P+    SP   +S    + Q
Sbjct: 352 SVPGQPSTILSAPPSLLGRPMTPSASPFPQTSQSPTAFQ 390


>08_02_1098 - 24291138-24291851,24292607-24292861
          Length = 322

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 13/40 (32%), Positives = 19/40 (47%)
 Frame = +3

Query: 159 ARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTS 278
           A C Y  +   G   + G+   +P G C+ P  P +YH S
Sbjct: 219 AACAYSYNRTGG---IAGKKCNIPNGSCNYPTCPKSYHGS 255


>07_03_0234 + 15561003-15561482,15562495-15562590,15562663-15562758
          Length = 223

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 16/60 (26%), Positives = 25/60 (41%)
 Frame = +3

Query: 135 PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSS 314
           P  APR ++    P + PR   + P   +  P GP   P +        LR S+A  + +
Sbjct: 73  PNPAPRSRSSRRSPLASPRTGTASPLSAAVAPGGPAPSPASAAVSSVGDLRSSAASQMEA 132


>06_03_0868 -
           25544933-25544938,25544939-25545142,25545494-25545751,
           25546625-25546906
          Length = 249

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 14/35 (40%), Positives = 16/35 (45%)
 Frame = +3

Query: 156 QARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           QA    P + PR P   P RPS  PR    +  AP
Sbjct: 2   QALLLSPAAAPRPPLPAPRRPSLPPRATSILTPAP 36


>02_04_0413 + 22681957-22682035,22682253-22682788
          Length = 204

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 17/50 (34%), Positives = 19/50 (38%), Gaps = 7/50 (14%)
 Frame = +3

Query: 123 CAP*PASA---PRCQARCCYPCSLPRGPCSVPGRP----SCLPRGPCSVP 251
           C P P+     P C+  CC  C    G C  P  P     C P  PC  P
Sbjct: 129 CPPSPSCENHHPPCKPGCCC-CGCSGGECPPPPSPPCQHECPPTPPCEHP 177


>01_05_0624 + 23772613-23774671,23774737-23775596
          Length = 972

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 13/36 (36%), Positives = 19/36 (52%)
 Frame = -3

Query: 132 MAHNALGRNGFSGRVVHGSSQKSSFRHRDQSTQYYD 25
           + H  L R GF GRV H     S+ +  D +++ YD
Sbjct: 159 LTHLNLARMGFYGRVPHQLGNLSNLQFLDITSEIYD 194


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,093,621
Number of Sequences: 37544
Number of extensions: 306269
Number of successful extensions: 915
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 874
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 914
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1874582652
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).