SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30015
         (660 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_01_0071 - 522920-523063,524125-524212,524289-524677                136   1e-32
03_06_0010 + 30990002-30990273,30990372-30990488,30990581-309906...   134   4e-32
03_06_0007 - 30975910-30975921,30976660-30976747,30976850-309769...    49   3e-06
11_04_0056 + 12942802-12942920,12943022-12943115                       36   0.022
04_03_0232 - 13049649-13052807                                         33   0.20 
02_05_0024 + 25152090-25153151,25153232-25154145,25154499-251547...    30   1.9  
10_08_0509 + 18419815-18422150,18422249-18422291,18423154-184234...    28   7.6  
07_01_0456 - 3461827-3462261,3462542-3462670,3462777-3462897,346...    28   7.6  
02_05_0220 - 26885502-26885561,26885940-26886739,26887055-268874...    28   7.6  

>07_01_0071 - 522920-523063,524125-524212,524289-524677
          Length = 206

 Score =  136 bits (330), Expect = 1e-32
 Identities = 68/164 (41%), Positives = 89/164 (54%)
 Frame = +3

Query: 3   GFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRK 182
           G   + +V+D R H+LGRLA+++AK LL G +VVVVRCE++ ISG   R K+K + FLRK
Sbjct: 6   GLCTRRVVVDARHHMLGRLASLVAKELLNGQRVVVVRCEEMCISGGLVRQKMKYLRFLRK 65

Query: 183 RCNVNPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXX 362
           R N  P+ GP HFRAPS+I W+TV      K       L       G   P         
Sbjct: 66  RMNTKPSHGPIHFRAPSRIFWRTVRGMIPHKTPRGEAALANLKAFDGVPPPYDRTKRMVV 125

Query: 363 XXXXXXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                          C +G+LS E+GW Y D +R+LE+KRK KA
Sbjct: 126 PDALKVLRLQPGHKYCLLGQLSKEVGWNYHDTIRELEEKRKEKA 169


>03_06_0010 +
           30990002-30990273,30990372-30990488,30990581-30990668,
           30991505-30991648
          Length = 206

 Score =  134 bits (325), Expect = 4e-32
 Identities = 68/158 (43%), Positives = 88/158 (55%)
 Frame = +3

Query: 21  IVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNVNP 200
           +V+D R H+LGRLA++IAK LL G +VVVVRCE+I +SG   R K+K + FLRKR N  P
Sbjct: 12  VVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKP 71

Query: 201 ARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXXXXXX 380
           + GP HFR+P+KILW+TV      K       L       G   P               
Sbjct: 72  SHGPIHFRSPAKILWRTVRGMIPHKTKRGEAALARLKAYEGVPPPYDRTKRMVIPDALKV 131

Query: 381 XXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                    C +G+LS E+GW Y D +R+LE+KRK KA
Sbjct: 132 LRLQPGHKYCLLGQLSKEVGWNYYDTIRELEEKRKEKA 169


>03_06_0007 -
           30975910-30975921,30976660-30976747,30976850-30976966,
           30977081-30977154
          Length = 96

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 27/92 (29%), Positives = 35/92 (38%)
 Frame = +3

Query: 189 NVNPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXX 368
           N  P+ GP HFR+P+KILW+TV      K       L           P           
Sbjct: 2   NTKPSHGPIHFRSPAKILWRTVRGMIPHKTKRGEAALARLKAYEVVTPPYDRTKRMVIPD 61

Query: 369 XXXXXXXXXXXXXCHVGRLSHEIGWKYRDVVR 464
                        C +G+LS E+GW Y D +R
Sbjct: 62  ALKVLRLQPGHKYCLLGQLSKEVGWNYYDTIR 93



 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 22/50 (44%), Positives = 28/50 (56%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFDNXXXXXXXXXXXXFCLKPGRK 403
           RGMIPHKT+RG+ AL RL+ Y+   PP+D               L+PG K
Sbjct: 24  RGMIPHKTKRGEAALARLKAYEVVTPPYDRTKRMVIPDALKVLRLQPGHK 73


>11_04_0056 + 12942802-12942920,12943022-12943115
          Length = 70

 Score = 36.3 bits (80), Expect = 0.022
 Identities = 16/41 (39%), Positives = 21/41 (51%)
 Frame = +2

Query: 281 RGKNALRRLRTYDGCPPPFDNXXXXXXXXXXXXFCLKPGRK 403
           RG+ AL RL+ Y+G PPP+D               L+PG K
Sbjct: 9   RGEAALARLKAYEGVPPPYDRTKRMVIPDALKVLRLQPGHK 49


>04_03_0232 - 13049649-13052807
          Length = 1052

 Score = 33.1 bits (72), Expect = 0.20
 Identities = 17/41 (41%), Positives = 22/41 (53%)
 Frame = -1

Query: 534 GDPLKFLFMALS*QPCPSSCLQAYEQHHGISIQFHGTVCLH 412
           GD   F++M     PCPS+CL+ Y  H  IS+Q      LH
Sbjct: 753 GDAPSFIYM----WPCPSNCLKPYSAHCYISVQDEMQTNLH 789


>02_05_0024 +
           25152090-25153151,25153232-25154145,25154499-25154709,
           25154757-25154921
          Length = 783

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 19/63 (30%), Positives = 28/63 (44%)
 Frame = +1

Query: 64  QSSPRSFSKGTKLLWFAANKSIFLATSLGTNSSLCHSCVRGAT*ILLVDLSILELHLRFY 243
           Q+SP   +   +L WF  N ++   + LG     C   +   T    +DLS L    + Y
Sbjct: 567 QNSPTDNTSSERLQWFRENSTV---SELGLEPGQCKVFIESDTVGRNLDLSSLASFEQLY 623

Query: 244 GRL 252
           GRL
Sbjct: 624 GRL 626


>10_08_0509 +
           18419815-18422150,18422249-18422291,18423154-18423487,
           18423766-18423878,18424461-18424589,18424771-18424864,
           18424967-18425050,18425859-18426047,18426897-18427017,
           18427476-18427692
          Length = 1219

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 15/41 (36%), Positives = 20/41 (48%)
 Frame = +1

Query: 112 AANKSIFLATSLGTNSSLCHSCVRGAT*ILLVDLSILELHL 234
           A+  S+FL    G      HSC+RG    L V+  + E HL
Sbjct: 759 ASTASLFLDLLSGGKYQEYHSCIRGGIFSLCVNSEVQENHL 799


>07_01_0456 -
           3461827-3462261,3462542-3462670,3462777-3462897,
           3463004-3463086,3463087-3463124,3463219-3464153,
           3464407-3464655,3464738-3465195,3465793-3465885,
           3466402-3466650
          Length = 929

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 2/56 (3%)
 Frame = -2

Query: 557 DTFSPASLVILLSFFSWHSL-NSLALPLVF-KLTNNITVFPSNFMGQSAYMTVIYG 396
           D    +SL +L+ F S+    N   L L   K T+  T+ P NF+ + A    IYG
Sbjct: 478 DAIHNSSLKVLIWFCSYFKQPNKHVLKLSHSKSTDGFTICPDNFLHEFAMFLSIYG 533


>02_05_0220 - 26885502-26885561,26885940-26886739,26887055-26887421,
            26887942-26888055,26888132-26888228,26889115-26889235,
            26889306-26889390,26889494-26889643,26889871-26889987,
            26890123-26890221,26890439-26890495,26890581-26890664,
            26890759-26890828,26891015-26891169,26891557-26892095,
            26892327-26892393,26892436-26892984,26893574-26893768,
            26894485-26894569,26895822-26896441,26897154-26897486,
            26897552-26897616,26897868-26897955,26898250-26898331,
            26898720-26898796,26899152-26899256,26899496-26899630,
            26900199-26900888,26901474-26902261,26902990-26904673
          Length = 2825

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 14/37 (37%), Positives = 21/37 (56%)
 Frame = +3

Query: 60   AAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMS 170
            A   A   ++ + VVVV CE+  I+G    N +KL+S
Sbjct: 2515 AIAFAASAIQNSSVVVVTCEREVITGGHADNSVKLIS 2551


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,967,427
Number of Sequences: 37544
Number of extensions: 400328
Number of successful extensions: 1032
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1001
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1026
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1655832080
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).