SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30014
         (611 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_02_0546 - 9381989-9383733,9385838-9386054                          131   4e-31
05_05_0109 - 22454539-22456268,22457069-22457279                      130   8e-31
01_06_1291 + 36032088-36032299,36032737-36033314,36034494-36036229    128   3e-30
11_08_0075 + 28173220-28173433,28175348-28177083                      127   6e-30
03_06_0484 + 34233042-34233258,34235317-34237049                      126   2e-29
03_02_0540 + 9340379-9340592,9341250-9342988                          126   2e-29
02_01_0112 - 839048-839552,839638-839720,839828-839982,840078-84...   104   6e-23
05_04_0392 - 20889699-20891726                                        102   2e-22
08_01_0654 - 5639419-5641449                                          101   3e-22
02_05_0916 - 32706039-32706332,32707483-32708103,32708450-327090...   100   8e-22
03_01_0093 - 745434-746057,746492-747112,747222-747791,747870-74...   100   2e-21
03_02_0542 - 9348126-9349585,9352433-9352655                           99   2e-21
05_04_0052 - 17515344-17517353                                         98   4e-21
11_01_0564 - 4447078-4448519,4449465-4449711                           95   4e-20
05_03_0397 + 13488642-13488941,13489711-13489963,13490594-134906...    93   1e-19
03_05_0877 + 28443481-28443538,28443641-28443911,28444028-284442...    92   3e-19
11_01_0565 - 4457019-4457052,4457175-4458675,4460791-4460836           90   1e-18
11_01_0563 + 4423609-4423846,4424671-4426132,4428949-4429364,443...    89   3e-18
03_02_0180 - 6211823-6213559                                           63   1e-10
01_05_0122 + 18366119-18367014,18367042-18367397,18367471-18368165     49   3e-06
06_03_0069 + 16179765-16179936,16179982-16180256                       44   1e-04
02_02_0556 - 11444512-11445577,11445730-11446007                       34   0.077
07_01_0181 + 1274177-1274200,1274335-1276161,1276519-1277448,127...    32   0.41 
01_06_0316 - 28419072-28419373,28419405-28420502,28420600-28420819     31   0.72 
01_05_0487 + 22641133-22642182,22642276-22642863,22642961-226430...    31   0.72 
04_04_1466 - 33799104-33799229,33799659-33799669,33800052-338002...    31   0.95 
10_06_0115 - 10930295-10930777                                         30   1.3  
03_04_0229 - 19018521-19018927,19019132-19019795                       29   2.2  
12_01_0754 - 6816789-6816886,6816922-6817722,6818377-6819058           29   2.9  
03_05_0704 - 26953474-26953643,26953770-26953801,26953915-269540...    29   2.9  
02_02_0157 - 7280335-7280541,7280656-7280762,7280918-7281097,728...    29   2.9  
07_03_0356 - 17142019-17142899,17145251-17145290,17145381-171455...    29   3.8  
07_03_0075 - 13096386-13096554,13096642-13096766,13096851-130971...    28   5.1  
08_02_0339 + 15968610-15969227,15969304-15969708,15969817-15969981     28   6.7  
03_02_0025 + 5084003-5084303,5084449-5084639,5084793-5084873,508...    28   6.7  
09_02_0302 - 7086017-7086124,7086125-7086796,7087511-7088070,708...    27   8.9  
05_07_0029 - 27163121-27163818,27163992-27164067,27164184-271658...    27   8.9  
05_05_0145 - 22690212-22690472,22690701-22690818,22691125-226912...    27   8.9  
04_01_0484 - 6352556-6352881,6352927-6353692                           27   8.9  

>03_02_0546 - 9381989-9383733,9385838-9386054
          Length = 653

 Score =  131 bits (317), Expect = 4e-31
 Identities = 61/77 (79%), Positives = 67/77 (87%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGER  TKDNNLLGKFELTGIPPAPRGVPQI VTFDIDANGILNVSA
Sbjct: 438 YSDNQPGVLIQVYEGERTRTKDNNLLGKFELTGIPPAPRGVPQINVTFDIDANGILNVSA 497

Query: 227 IEKSTNKENRSPLPTTK 277
            +K+T K+N+  +   K
Sbjct: 498 EDKTTGKKNKITITNDK 514



 Score = 58.4 bits (135), Expect = 4e-09
 Identities = 26/34 (76%), Positives = 31/34 (91%)
 Frame = +1

Query: 253 QITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           +ITITNDKGRLSKEEIERMV EAEKY+ ED++ +
Sbjct: 507 KITITNDKGRLSKEEIERMVQEAEKYKAEDEQVR 540


>05_05_0109 - 22454539-22456268,22457069-22457279
          Length = 646

 Score =  130 bits (314), Expect = 8e-31
 Identities = 66/140 (47%), Positives = 89/140 (63%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERA TKDNNLLGKFEL+GIPPAPRGVPQI V FDIDANGILNVSA
Sbjct: 436 YSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSA 495

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +K+T ++N+  +   K    ++     +      +      K+ +  +  +     +  
Sbjct: 496 EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNM- 554

Query: 407 SATMEDEKLKEKILLNSDKQ 466
             T++DEK+  K+  +  K+
Sbjct: 555 RNTIKDEKIASKLAADDKKR 574


>01_06_1291 + 36032088-36032299,36032737-36033314,36034494-36036229
          Length = 841

 Score =  128 bits (309), Expect = 3e-30
 Identities = 65/140 (46%), Positives = 89/140 (63%)
 Frame = +2

Query: 47   YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
            YSDNQPGVLIQV+EGERA TKDNNLLGKFEL+GIPPAPRGVPQI V FDIDANGILNVSA
Sbjct: 629  YSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSA 688

Query: 227  IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
             +K+T ++N+  +   K    ++     +      +      K+ +  +  +     +  
Sbjct: 689  EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNM- 747

Query: 407  SATMEDEKLKEKILLNSDKQ 466
              T++D+K+  K+  +  K+
Sbjct: 748  RNTIKDDKIASKLSADDKKK 767


>11_08_0075 + 28173220-28173433,28175348-28177083
          Length = 649

 Score =  127 bits (307), Expect = 6e-30
 Identities = 67/142 (47%), Positives = 92/142 (64%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGER  T+DNNLLGKFEL+GIPPAPRGVPQI V FDIDANGILNVSA
Sbjct: 437 YSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSA 496

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +K+T ++N+  +   K    ++     +      ++     K+ ++ +  +     +  
Sbjct: 497 EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNM- 555

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
             T++DEK+  K L  +DK+ I
Sbjct: 556 RNTIKDEKIASK-LPAADKKKI 576


>03_06_0484 + 34233042-34233258,34235317-34237049
          Length = 649

 Score =  126 bits (303), Expect = 2e-29
 Identities = 64/140 (45%), Positives = 89/140 (63%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGER  T+DNNLLGKFEL+GIPPAPRGVPQI V FDIDANGILNVSA
Sbjct: 438 YSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSA 497

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +K+T ++N+  +   K    ++     +      ++     K+ +  +  +     +  
Sbjct: 498 EDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVDAKNSLENYAYNM- 556

Query: 407 SATMEDEKLKEKILLNSDKQ 466
             T++DEK+  K+  +  K+
Sbjct: 557 RNTIQDEKIASKLPADDKKK 576


>03_02_0540 + 9340379-9340592,9341250-9342988
          Length = 650

 Score =  126 bits (303), Expect = 2e-29
 Identities = 67/142 (47%), Positives = 90/142 (63%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGER  TKDNNLLGKFEL+GIPPAPRGVPQI V FDIDANGILNVSA
Sbjct: 437 YSDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSA 496

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +K+T ++N+  +   K    ++     +      +      K+ +  +  +     +  
Sbjct: 497 EDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEEHKKKVDAKNSLENYAYNM- 555

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
             T++D+K+  K L  +DK+ I
Sbjct: 556 RNTIKDDKIASK-LPEADKKKI 576


>02_01_0112 -
           839048-839552,839638-839720,839828-839982,840078-840557,
           840855-841097,841189-841403,841489-841756,842477-842525
          Length = 665

 Score =  104 bits (249), Expect = 6e-23
 Identities = 49/77 (63%), Positives = 57/77 (74%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y D Q  V IQVFEGER+MTKD  LLGKF+L+GIP APRG PQIEVTF++DANGILNV A
Sbjct: 460 YQDQQTTVSIQVFEGERSMTKDCRLLGKFDLSGIPAAPRGTPQIEVTFEVDANGILNVKA 519

Query: 227 IEKSTNKENRSPLPTTK 277
            +K T K  +  +   K
Sbjct: 520 EDKGTGKSEKITITNEK 536



 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 24/37 (64%), Positives = 31/37 (83%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           + E+ITITN+KGRLS+EEI+RMV EAE++  ED K K
Sbjct: 526 KSEKITITNEKGRLSQEEIDRMVREAEEFAEEDKKVK 562


>05_04_0392 - 20889699-20891726
          Length = 675

 Score =  102 bits (245), Expect = 2e-22
 Identities = 46/70 (65%), Positives = 56/70 (80%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y D Q  V IQVFEGER+MT+DN LLGKF+LTGI PAPRG PQI VTF++DANGIL+V A
Sbjct: 472 YKDRQTTVTIQVFEGERSMTRDNRLLGKFDLTGIAPAPRGAPQIAVTFEVDANGILSVLA 531

Query: 227 IEKSTNKENR 256
            +K+T +  +
Sbjct: 532 ADKATGRSEK 541



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 28/108 (25%), Positives = 54/108 (50%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGDHPGPRMHWNLTGFSMKCYHGG 423
           + E+ITI+ D  ++S+EEI+RMV EAE++ +ED + + +    R       +++K   GG
Sbjct: 538 RSEKITISGDDRKISQEEIDRMVREAEEFADEDRRHR-EQVDARNSLEAYVYNVKSTLGG 596

Query: 424 *EAQGKDSPEL*QADHSSNKCNIHPFKWMGFPVQAGRARRSMSTRQKE 567
             A   +  E  + + +  + +    +W+     AG+       R+ E
Sbjct: 597 KMADAMEGEEKEKVEEAVREAH----EWLDGNPDAGKEEYEEKLRELE 640


>08_01_0654 - 5639419-5641449
          Length = 676

 Score =  101 bits (243), Expect = 3e-22
 Identities = 45/70 (64%), Positives = 56/70 (80%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y D Q  V IQVFEGER+MT+DN LLG+F+L GI PAPRG PQIEVTF++DANGIL+V A
Sbjct: 472 YKDKQTTVTIQVFEGERSMTRDNRLLGRFDLAGIAPAPRGAPQIEVTFEVDANGILSVLA 531

Query: 227 IEKSTNKENR 256
            +K+T +  +
Sbjct: 532 ADKATGRSEK 541



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 28/108 (25%), Positives = 53/108 (49%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGDHPGPRMHWNLTGFSMKCYHGG 423
           + E+ITI+ D  ++S+EEI+RMV EAE++  E+D+   +    R       +++K   GG
Sbjct: 538 RSEKITISGDDRKISQEEIDRMVREAEEFA-EEDRRHREQVDARNSLEAYVYNIKNTLGG 596

Query: 424 *EAQGKDSPEL*QADHSSNKCNIHPFKWMGFPVQAGRARRSMSTRQKE 567
             A   +  E  + + +  +     ++W+     AG+       R+ E
Sbjct: 597 KMADAMEGEEKDKVEEAVREA----YEWLDGNPDAGKEEYEEKLRELE 640


>02_05_0916 -
           32706039-32706332,32707483-32708103,32708450-32709070,
           32709183-32709752,32709840-32709918,32710002-32710075,
           32711336-32711398
          Length = 773

 Score =  100 bits (240), Expect = 8e-22
 Identities = 47/69 (68%), Positives = 56/69 (81%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +DNQ  V I+V +GER M  DN LLG+F+L GIPPAPRG+PQIEVTFDIDANGI+ VSA 
Sbjct: 475 ADNQTQVGIRVLQGEREMATDNKLLGEFDLVGIPPAPRGMPQIEVTFDIDANGIVTVSAK 534

Query: 230 EKSTNKENR 256
           +KST KE +
Sbjct: 535 DKSTGKEQQ 543


>03_01_0093 -
           745434-746057,746492-747112,747222-747791,747870-747948,
           748258-748331,748385-748387
          Length = 656

 Score = 99.5 bits (237), Expect = 2e-21
 Identities = 46/69 (66%), Positives = 56/69 (81%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +DNQ  V I+V +GER M  DN LLG+F+L GIPPAPRG+PQIEVTFDIDANGI+ VSA 
Sbjct: 455 ADNQTQVGIKVLQGEREMAADNKLLGEFDLVGIPPAPRGMPQIEVTFDIDANGIVTVSAK 514

Query: 230 EKSTNKENR 256
           +K+T KE +
Sbjct: 515 DKATGKEQQ 523


>03_02_0542 - 9348126-9349585,9352433-9352655
          Length = 560

 Score = 99.1 bits (236), Expect = 2e-21
 Identities = 48/75 (64%), Positives = 55/75 (73%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           DN+  VLI V EGE   TKDNN LGKF LTGIPPAPRGVPQI VTF ID NGI+NVSA +
Sbjct: 451 DNETAVLINVNEGEGRRTKDNNPLGKFVLTGIPPAPRGVPQINVTFSIDYNGIMNVSAED 510

Query: 233 KSTNKENRSPLPTTK 277
           K+T + N   + + K
Sbjct: 511 KTTGRSNSITIKSDK 525



 Score = 51.6 bits (118), Expect = 5e-07
 Identities = 23/35 (65%), Positives = 29/35 (82%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           +   ITI +DKGRLSKEEIERMV +AEKY+ ED++
Sbjct: 515 RSNSITIKSDKGRLSKEEIERMVKKAEKYKAEDEE 549


>05_04_0052 - 17515344-17517353
          Length = 669

 Score = 98.3 bits (234), Expect = 4e-21
 Identities = 42/70 (60%), Positives = 56/70 (80%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y D Q  V ++VFEGER+MT+DN LLG+F+L GI PAPRG PQIEV F++DA+GIL+VSA
Sbjct: 468 YKDKQTTVTVKVFEGERSMTRDNRLLGRFDLAGIAPAPRGAPQIEVAFEVDADGILSVSA 527

Query: 227 IEKSTNKENR 256
            +++T +  R
Sbjct: 528 ADRATGRSER 537



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/33 (48%), Positives = 26/33 (78%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNED 342
           + E+ITI+ D  + S+EEI+RM+ EAE++ +ED
Sbjct: 534 RSERITISGDDRKTSREEIDRMLGEAEEFADED 566


>11_01_0564 - 4447078-4448519,4449465-4449711
          Length = 562

 Score = 95.1 bits (226), Expect = 4e-20
 Identities = 45/67 (67%), Positives = 52/67 (77%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           DNQ  V   V+EGE A TKDNNLLG+F L GIPPAP+ VP I+VTFDIDANG+LNVSA  
Sbjct: 459 DNQINVSFPVYEGESANTKDNNLLGEFTLYGIPPAPKRVPSIDVTFDIDANGVLNVSAEH 518

Query: 233 KSTNKEN 253
           K T ++N
Sbjct: 519 KVTGQKN 525



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +1

Query: 232 EVHQQGEQITITNDKGRLSKEEIERMVNEAEKYR 333
           +V  Q   ITITN  GRL+KEEI+RM  EAE+++
Sbjct: 519 KVTGQKNSITITNRSGRLNKEEIDRMALEAERHK 552


>05_03_0397 +
           13488642-13488941,13489711-13489963,13490594-13490673,
           13491251-13491393,13491512-13491610,13491785-13491974,
           13492504-13492902,13492993-13493400
          Length = 623

 Score = 93.5 bits (222), Expect = 1e-19
 Identities = 43/67 (64%), Positives = 50/67 (74%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D Q  V I V +GER   +DN  LG F L GIPPAPRGVPQIEV FDIDANGIL+VSA+
Sbjct: 407 ADGQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVSAV 466

Query: 230 EKSTNKE 250
           +K T K+
Sbjct: 467 DKGTGKK 473



 Score = 34.3 bits (75), Expect = 0.077
 Identities = 19/37 (51%), Positives = 24/37 (64%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGD 360
           + ITIT     L K+E+E+MV EAEK+  E DK K D
Sbjct: 474 QDITITG-ASTLPKDEVEKMVEEAEKFAKE-DKEKRD 508


>03_05_0877 +
           28443481-28443538,28443641-28443911,28444028-28444242,
           28444329-28445057,28445143-28445297,28445384-28445965
          Length = 669

 Score = 92.3 bits (219), Expect = 3e-19
 Identities = 42/77 (54%), Positives = 57/77 (74%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y D+Q  V I+VFEGER++TKD   LG+F+L+GI PAPRGVPQIEVTF++D NGIL+V+A
Sbjct: 466 YEDHQTTVSIKVFEGERSLTKDCRELGRFDLSGIAPAPRGVPQIEVTFEVDENGILHVTA 525

Query: 227 IEKSTNKENRSPLPTTK 277
            +K+  +     +   K
Sbjct: 526 SDKAAGRSKSITITNDK 542



 Score = 51.2 bits (117), Expect = 6e-07
 Identities = 22/37 (59%), Positives = 30/37 (81%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           + + ITITNDKGRLS+EEI+RMV EAE++  ED + +
Sbjct: 532 RSKSITITNDKGRLSQEEIDRMVREAEEFAEEDRRVR 568


>11_01_0565 - 4457019-4457052,4457175-4458675,4460791-4460836
          Length = 526

 Score = 89.8 bits (213), Expect = 1e-18
 Identities = 50/107 (46%), Positives = 65/107 (60%), Gaps = 2/107 (1%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           DNQ  V   VFEGE A T DNNLLGKF L+G+ PAPRGVPQI+VTFD D NG+L+V A +
Sbjct: 412 DNQIRVSFPVFEGESASTLDNNLLGKFVLSGVLPAPRGVPQIDVTFDFDTNGVLHVFAED 471

Query: 233 KSTNKENRSPLPTTKVVSPRKRSSVWLMRQ--RSTETRMTRQKETIQ 367
             T  +N + +  T      K+  V  M +  RS   +  R + ++Q
Sbjct: 472 MGTGSKNNNTI--TNHSGRLKKEDVERMSREARSYNRKRKRTRSSLQ 516


>11_01_0563 +
           4423609-4423846,4424671-4426132,4428949-4429364,
           4430555-4432052,4432199-4432217,4432469-4432675,
           4432814-4433065
          Length = 1363

 Score = 89.0 bits (211), Expect = 3e-18
 Identities = 49/99 (49%), Positives = 60/99 (60%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           DNQ  V I VFEGE A    NNLLGKF L+GI PAPRGVPQI+VTF+ DANG+L+VSA +
Sbjct: 467 DNQIAVSINVFEGESASILRNNLLGKFVLSGILPAPRGVPQIDVTFEFDANGVLHVSAKD 526

Query: 233 KSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTR 349
             T  +N   +  T      K+  V  M + +     TR
Sbjct: 527 MGTGSKNN--IAITNHSGRLKKEDVERMAREARSYNRTR 563



 Score = 79.8 bits (188), Expect = 2e-15
 Identities = 38/69 (55%), Positives = 51/69 (73%)
 Frame = +2

Query: 47   YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
            + D Q  V I+VFEGE A TK+N LLG+F L+GI PAP GV +I+ T +IDANG+L+VSA
Sbjct: 1099 HRDMQTSVSIKVFEGESASTKNNYLLGEFVLSGITPAPAGVARIDETLEIDANGVLHVSA 1158

Query: 227  IEKSTNKEN 253
             +  T ++N
Sbjct: 1159 EDMGTGRKN 1167



 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 29/48 (60%), Positives = 36/48 (75%)
 Frame = +2

Query: 110  DNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIEKSTNKEN 253
            DN+L   F L GIPPAP GVP  +VTFDID NG+LNV+A +K T ++N
Sbjct: 1277 DNDL---FRLFGIPPAPMGVPHFDVTFDIDGNGVLNVTAEDKDTGRKN 1321



 Score = 37.9 bits (84), Expect = 0.006
 Identities = 16/33 (48%), Positives = 21/33 (63%)
 Frame = +1

Query: 256  ITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
            ITITN  GRL KE++ERM  EA  Y  +  + +
Sbjct: 1169 ITITNHSGRLKKEDVERMSREARSYNRKRKRTR 1201



 Score = 37.9 bits (84), Expect = 0.006
 Identities = 17/26 (65%), Positives = 21/26 (80%)
 Frame = +1

Query: 256  ITITNDKGRLSKEEIERMVNEAEKYR 333
            I I+N  GRL+KEEIERM  EAE+Y+
Sbjct: 1323 IIISNRSGRLNKEEIERMALEAERYK 1348


>03_02_0180 - 6211823-6213559
          Length = 578

 Score = 63.3 bits (147), Expect = 1e-10
 Identities = 30/58 (51%), Positives = 38/58 (65%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           DNQ   LI V+EGE    +DN+LLG F++TGIP A +G  +I V  DIDA  +L V A
Sbjct: 470 DNQTEALIAVYEGEGNQAEDNHLLGYFKITGIPAAAKGTVEINVCMDIDAGNVLRVFA 527


>01_05_0122 + 18366119-18367014,18367042-18367397,18367471-18368165
          Length = 648

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 30/69 (43%), Positives = 38/69 (55%), Gaps = 6/69 (8%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAP------RGVPQIEVTFDIDANG 208
           Y   Q  V I VF+GE +  KDN L G+  LTGIPPA       R  P I+VT  +D  G
Sbjct: 460 YLGRQTAVAINVFQGEGSTAKDNTLFGRLVLTGIPPASVWNWGWRWRP-IQVTVKVDELG 518

Query: 209 ILNVSAIEK 235
            ++V A +K
Sbjct: 519 DIHVEATDK 527



 Score = 29.5 bits (63), Expect = 2.2
 Identities = 12/27 (44%), Positives = 20/27 (74%)
 Frame = +1

Query: 268 NDKGRLSKEEIERMVNEAEKYRNEDDK 348
           ++ GRLSKEEI+RM+ E  +   E+++
Sbjct: 544 HEHGRLSKEEIDRMIREVAEDLVEEER 570


>06_03_0069 + 16179765-16179936,16179982-16180256
          Length = 148

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 28/85 (32%), Positives = 43/85 (50%)
 Frame = +1

Query: 88  G*ACYDQR*QLAR*IRADRDPTGAAWRASN*GHLRHRCQRYPQRFRYREVHQQGEQITIT 267
           G A +D+    A  +R  R   G    A++ G LRH  +R+PQR    + H+Q  +    
Sbjct: 61  GRAKHDEGQPAAWQVRLHRHRVGVERAAADRGDLRHGRERHPQRVGRGQGHRQVGEDHYL 120

Query: 268 NDKGRLSKEEIERMVNEAEKYRNED 342
             +     EEI+RMV +AE++  ED
Sbjct: 121 QRQPTPEPEEIDRMVGKAEEFAEED 145


>02_02_0556 - 11444512-11445577,11445730-11446007
          Length = 447

 Score = 34.3 bits (75), Expect = 0.077
 Identities = 17/47 (36%), Positives = 26/47 (55%)
 Frame = +1

Query: 193 HRCQRYPQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEAEKYR 333
           H  +  PQ  RY  +H   E + I +DK  LS++E  R++   EK+R
Sbjct: 258 HELKPLPQGIRYAFLHNDREALVIISDK--LSEDETRRLLTMLEKHR 302


>07_01_0181 +
           1274177-1274200,1274335-1276161,1276519-1277448,
           1278314-1278367
          Length = 944

 Score = 31.9 bits (69), Expect = 0.41
 Identities = 16/62 (25%), Positives = 30/62 (48%)
 Frame = +1

Query: 184 HLRHRCQRYPQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGDH 363
           +L   C+ +P+RF   +V  + +     +D      E+ E+MV    +   +DD+ +GD 
Sbjct: 168 NLIQECREHPERFEDDDVEDKDDDDETDDDASDADIEDPEKMVMSESEEEGDDDE-EGDQ 226

Query: 364 PG 369
            G
Sbjct: 227 DG 228


>01_06_0316 - 28419072-28419373,28419405-28420502,28420600-28420819
          Length = 539

 Score = 31.1 bits (67), Expect = 0.72
 Identities = 13/26 (50%), Positives = 20/26 (76%)
 Frame = +1

Query: 271 DKGRLSKEEIERMVNEAEKYRNEDDK 348
           ++ +LSKEEIERM  EA++Y   D++
Sbjct: 500 EQSQLSKEEIERMTMEAKEYMAADEE 525



 Score = 28.7 bits (61), Expect = 3.8
 Identities = 12/27 (44%), Positives = 18/27 (66%)
 Frame = +2

Query: 176 IEVTFDIDANGILNVSAIEKSTNKENR 256
           + V F IDA+G+L VSA +K    +N+
Sbjct: 469 VSVCFSIDADGVLTVSARDKVNGHKNQ 495


>01_05_0487 +
           22641133-22642182,22642276-22642863,22642961-22643068,
           22643582-22643692,22643784-22643849,22644858-22644917,
           22644990-22645119,22645159-22645547,22645783-22645902,
           22645957-22646022,22646190-22646255
          Length = 917

 Score = 31.1 bits (67), Expect = 0.72
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = +1

Query: 184 HLRHRCQRYPQRFRYREVHQQGEQITITN-DKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           H+R   +   +R    E+ ++ E++     ++ RL +EE ERMV E +  + E DK K
Sbjct: 172 HVRVMLEVLAKRKEAEELRKREEELRKRKAEEERLQREEDERMVEEMKMQQKERDKGK 229


>04_04_1466 -
           33799104-33799229,33799659-33799669,33800052-33800200,
           33800261-33800299,33800690-33800746,33800839-33801628,
           33801705-33801980,33802051-33802117,33802211-33802285,
           33802618-33802812,33802927-33803076,33803152-33803522,
           33804070-33804193,33804246-33804275,33804306-33804417,
           33804919-33804985,33805138-33805180,33805768-33805872
          Length = 928

 Score = 30.7 bits (66), Expect = 0.95
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
 Frame = +2

Query: 146 IPPAPRGVPQIEVTFDIDANGILNVSAIEKSTNKENRSPLPT--TKVVSPRKRSSVWLMR 319
           IPPA  GV  +   F +DAN   NV      T +  + P+P    + +  +K +SV    
Sbjct: 304 IPPAAFGVGNVTEAFPVDANTPFNV------TERSKKPPVPNWLREELLKKKSTSVSASV 357

Query: 320 QRSTE 334
           Q STE
Sbjct: 358 QHSTE 362


>10_06_0115 - 10930295-10930777
          Length = 160

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 16/41 (39%), Positives = 24/41 (58%)
 Frame = +1

Query: 211 PQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEAEKYR 333
           P+  RY  +H   E   I +DK  LSK+E +R++   EK+R
Sbjct: 15  PEGLRYAFLHNDKEAPVIISDK--LSKDETQRLLFVLEKHR 53


>03_04_0229 - 19018521-19018927,19019132-19019795
          Length = 356

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 16/41 (39%), Positives = 24/41 (58%)
 Frame = +1

Query: 214 QRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRN 336
           Q  RY  +H   E   + +DK  LSK+EI R++   EK+R+
Sbjct: 221 QGLRYAFLHGDKEAPVVISDK--LSKDEINRLLAMLEKHRS 259


>12_01_0754 - 6816789-6816886,6816922-6817722,6818377-6819058
          Length = 526

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 10/27 (37%), Positives = 17/27 (62%)
 Frame = +1

Query: 502 KWMGFPVQAGRARRSMSTRQKELGRAF 582
           +W+GFP + GR+RRS    +  + + F
Sbjct: 103 RWLGFPFRVGRSRRSKGMEEVVIMKRF 129


>03_05_0704 -
           26953474-26953643,26953770-26953801,26953915-26954009,
           26954107-26954180,26954283-26954412,26954522-26954585,
           26954660-26954722,26954795-26954937,26955386-26955523,
           26955610-26955731,26955805-26955976,26956559-26956630,
           26956753-26956887,26956987-26957103,26957184-26957316,
           26957455-26957561,26958060-26958077,26958235-26958379,
           26958472-26958671,26960744-26961421
          Length = 935

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 15/39 (38%), Positives = 22/39 (56%)
 Frame = +2

Query: 128 KFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIEKSTN 244
           ++++TGIP AP      E+ FD+D N I  V   +K  N
Sbjct: 368 RYKITGIPSAPMN----ELMFDLDGNRISVVQYFKKQYN 402


>02_02_0157 -
           7280335-7280541,7280656-7280762,7280918-7281097,
           7281182-7281277,7281378-7281459,7281553-7283037,
           7283376-7283450,7283521-7283598,7283708-7283791,
           7283885-7283965,7284073-7284291,7284398-7284648,
           7284748-7284796
          Length = 997

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 14/42 (33%), Positives = 25/42 (59%)
 Frame = +1

Query: 187 LRHRCQRYPQRFRYREVHQQGEQITITNDKGRLSKEEIERMV 312
           ++ R ++Y  R R  EV   G +     DKG+L+ E++ER++
Sbjct: 259 IKAREEKYQSRIRVLEVLAGGMEKDKFGDKGQLAVEDMERLM 300


>07_03_0356 -
           17142019-17142899,17145251-17145290,17145381-17145512,
           17145762-17145815,17145913-17145993,17146860-17146955,
           17147439-17147611,17147750-17147823,17148515-17148622,
           17148693-17148868,17149305-17149352,17150665-17150775,
           17152172-17152226,17153434-17153534,17154176-17154290,
           17155505-17155698
          Length = 812

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 17/67 (25%), Positives = 35/67 (52%), Gaps = 2/67 (2%)
 Frame = +1

Query: 190 RHRCQRYPQRFRYREVHQQGEQITITNDKGRLS--KEEIERMVNEAEKYRNEDDKAKGDH 363
           + + +   +R + RE  ++ +++    +K R    KE+IE  V +  K R +   AKG+ 
Sbjct: 668 KKKIEEAEERKKAREAKKRAKEVQAQKEKERAKQKKEQIES-VKKWRKQRQQGGFAKGND 726

Query: 364 PGPRMHW 384
            GP +++
Sbjct: 727 DGPDLNF 733


>07_03_0075 -
           13096386-13096554,13096642-13096766,13096851-13097117,
           13097506-13097587,13097956-13098172,13098260-13098360,
           13098425-13098627,13099261-13099334,13100246-13100429
          Length = 473

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 22/73 (30%), Positives = 37/73 (50%)
 Frame = +2

Query: 263 LPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA*SATMEDEKLKEK 442
           L +T  V+  K++ V LM+Q     +  +Q  +  G+  + I    A     +DEKLKE 
Sbjct: 184 LVSTAYVNLMKQAYVNLMKQGIMMEKPLQQWRSYDGRSDLDISEEMA----FKDEKLKEL 239

Query: 443 ILLNSDKQTIPRT 481
           +  N+ ++TI  T
Sbjct: 240 VYNNASERTIRHT 252


>08_02_0339 + 15968610-15969227,15969304-15969708,15969817-15969981
          Length = 395

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 9/18 (50%), Positives = 11/18 (61%)
 Frame = +1

Query: 463 ADHSSNKCNIHPFKWMGF 516
           ADH   +C   PFKWM +
Sbjct: 337 ADHLMRRCRSRPFKWMAW 354


>03_02_0025 +
           5084003-5084303,5084449-5084639,5084793-5084873,
           5084972-5085319,5085409-5086293
          Length = 601

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 4/64 (6%)
 Frame = +1

Query: 196 RCQRYPQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK----AKGDH 363
           R +R  +    RE  ++  +     +K R  +EE  R   E E+ R E+++     +GD 
Sbjct: 505 RKRREEEEKERREREEEERRQREKEEKKRREEEEQRREEEEEERRREEEEEEQEDGRGDE 564

Query: 364 PGPR 375
           P PR
Sbjct: 565 PKPR 568


>09_02_0302 -
           7086017-7086124,7086125-7086796,7087511-7088070,
           7088754-7089131,7089357-7089821,7090022-7090127,
           7090219-7090294,7090407-7090648,7090824-7090904,
           7091013-7091205,7091336-7091558,7091611-7091646,
           7091694-7091790
          Length = 1078

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 13/40 (32%), Positives = 20/40 (50%)
 Frame = +2

Query: 269 TTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGI 388
           TTKV     R SVW+        ++   +ETI+ +  +GI
Sbjct: 109 TTKVTDEESRQSVWVSGNLPINLKLVDIQETIKPEGVMGI 148


>05_07_0029 -
           27163121-27163818,27163992-27164067,27164184-27165896,
           27166285-27166364,27166516-27166684
          Length = 911

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 22/65 (33%), Positives = 31/65 (47%)
 Frame = +2

Query: 290 RKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA*SATMEDEKLKEKILLNSDKQT 469
           R+RS    M+Q  T  R +R  ET  GQ+   ++     +AT+E   L    +  S   T
Sbjct: 688 RRRSENCTMQQDGTNKRNSRCSETNFGQDSSNLIHPGEVAATVE---LLLTNVRRSTSTT 744

Query: 470 IPRTS 484
            PRTS
Sbjct: 745 PPRTS 749


>05_05_0145 -
           22690212-22690472,22690701-22690818,22691125-22691261,
           22691743-22691844,22691921-22692001,22692325-22692394,
           22692628-22692689,22692908-22693320,22693424-22693507,
           22694180-22694272,22694376-22694427,22694542-22694608,
           22694714-22694772,22694920-22695033,22695174-22695347,
           22695444-22695935,22696021-22696090,22696649-22696692
          Length = 830

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 17/73 (23%), Positives = 35/73 (47%)
 Frame = +1

Query: 148 PTGAAWRASN*GHLRHRCQRYPQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEAEK 327
           P   +WR  N G    +        +  + H Q E+IT  ND+ ++   +++ ++ E+  
Sbjct: 734 PFSLSWRDKNKG----KQNNVDDSAKLTDAHDQREEITNNNDEKQVETPKLD-VLEESMG 788

Query: 328 YRNEDDKAKGDHP 366
              ED+K++ + P
Sbjct: 789 SPKEDNKSRVEVP 801


>04_01_0484 - 6352556-6352881,6352927-6353692
          Length = 363

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 11/25 (44%), Positives = 17/25 (68%)
 Frame = +2

Query: 122 LGKFELTGIPPAPRGVPQIEVTFDI 196
           +GK   TG+PP  RG+P+  V ++I
Sbjct: 1   MGKAARTGLPPRRRGLPEEIVVWEI 25


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,641,825
Number of Sequences: 37544
Number of extensions: 417987
Number of successful extensions: 1424
Number of sequences better than 10.0: 39
Number of HSP's better than 10.0 without gapping: 1358
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1416
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1466594128
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).