SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30012
         (706 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_03_1365 + 29598130-29598523,29599016-29599078,29599292-29599398     31   0.89 
08_02_0229 - 14540302-14540736                                         30   2.1  
03_06_0316 + 33091194-33091370,33091451-33092155                       29   2.7  
12_02_0827 + 23492583-23492633,23493018-23493566,23493722-23494012     29   3.6  
04_04_0063 - 22441549-22442961                                         28   6.3  
02_02_0471 - 10714440-10714846,10714947-10715034,10715427-107155...    28   8.3  
01_06_1227 + 35531840-35532516,35532665-35532836,35533158-355333...    28   8.3  
01_06_0789 - 32010131-32010330,32010438-32010866,32011658-320117...    28   8.3  

>06_03_1365 + 29598130-29598523,29599016-29599078,29599292-29599398
          Length = 187

 Score = 31.1 bits (67), Expect = 0.89
 Identities = 21/48 (43%), Positives = 26/48 (54%)
 Frame = -3

Query: 422 VSTRISATESSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASRKA 279
           V+T  SA   S +S A  AAAA G  T  + +    SA+ GNAAS  A
Sbjct: 109 VTTDASACAKSASSSATAAAAAAGAGTAGSTAAS--SASTGNAASTAA 154


>08_02_0229 - 14540302-14540736
          Length = 144

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 19/50 (38%), Positives = 26/50 (52%)
 Frame = -2

Query: 366 CRRQGRVHHRDRVHQKSVRRQGKCCLQKGHLGIQNDHHSNSSVSAADRGR 217
           CRR+G      R  Q++ RR+G  C   G  G      +N++V AAD GR
Sbjct: 71  CRRRGGTSGGLRGKQRAGRRRGGGCDAGGGDGTAG-RRANAAVGAADDGR 119


>03_06_0316 + 33091194-33091370,33091451-33092155
          Length = 293

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 16/48 (33%), Positives = 26/48 (54%)
 Frame = -3

Query: 422 VSTRISATESSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASRKA 279
           ++T ++ATE  + +E   AAA +  +T       + + AK  AA RKA
Sbjct: 1   MATDVAATEPEVAAEEAAAAAPETTATAGDSKPAKEAKAKKAAAPRKA 48


>12_02_0827 + 23492583-23492633,23493018-23493566,23493722-23494012
          Length = 296

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 19/53 (35%), Positives = 26/53 (49%)
 Frame = -3

Query: 437 KRSTRVSTRISATESSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASRKA 279
           KRST+ S+  S+ +      A  AAA    STT T +    S+A   AA+  A
Sbjct: 148 KRSTKKSSSSSSRQGGGAGNA-AAAATSSSSTTSTSTTATTSSAAAPAAAAAA 199


>04_04_0063 - 22441549-22442961
          Length = 470

 Score = 28.3 bits (60), Expect = 6.3
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 2/57 (3%)
 Frame = -3

Query: 419 STRISATESSITSEAQTAAAAKGESTTETESIRRVSAAKG--NAASRKAT*GSRMTT 255
           +T  +AT  S  + A+TA+ A         S+R VS+AKG   AAS + T   +  T
Sbjct: 310 TTTTTATACSTPASARTASVADYGFDQHLPSVRLVSSAKGTPEAASHRWTAADKSRT 366


>02_02_0471 -
           10714440-10714846,10714947-10715034,10715427-10715516,
           10715614-10715727
          Length = 232

 Score = 27.9 bits (59), Expect = 8.3
 Identities = 16/49 (32%), Positives = 23/49 (46%)
 Frame = -3

Query: 425 RVSTRISATESSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASRKA 279
           +VST + A E  I  +  TAAAA+ E   E  +    + A G     +A
Sbjct: 127 KVSTLLPADEEEIKPKEATAAAAEEEKKEEAAAAAAATDAAGEEKKEEA 175


>01_06_1227 +
           35531840-35532516,35532665-35532836,35533158-35533357,
           35533467-35533622,35536878-35537235,35537407-35537418
          Length = 524

 Score = 27.9 bits (59), Expect = 8.3
 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 5/43 (11%)
 Frame = +2

Query: 80  GSVSFRPSTKCALSWYSPVWL---WPM--AALNLQWDTATPLP 193
           G +     T   L+W+ P+WL   W M  AA N+    AT +P
Sbjct: 410 GGIRCAKETMPLLNWHGPIWLGTDWDMFHAAANVSRTAATRVP 452


>01_06_0789 -
           32010131-32010330,32010438-32010866,32011658-32011752,
           32011836-32011933,32012586-32012942,32013615-32013792,
           32013856-32013936,32014441-32014548,32014916-32015178
          Length = 602

 Score = 27.9 bits (59), Expect = 8.3
 Identities = 12/31 (38%), Positives = 16/31 (51%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPRIPGVAPPQ 524
           P+++ H  VHVP P P       +P V P Q
Sbjct: 45  PVMRSHHVVHVPLPRPAVAVAVPVPQVRPAQ 75


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,516,348
Number of Sequences: 37544
Number of extensions: 270185
Number of successful extensions: 1347
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1231
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1342
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1815633512
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).