SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30011
         (766 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_02_0100 - 6783821-6784339,6784815-6784984,6785062-6785164,678...    79   4e-15
06_03_0500 + 21470681-21470952,21471049-21471089,21472322-214724...    77   2e-14
08_02_1101 - 24308433-24308978,24309195-24309364,24309443-243095...    74   1e-13
07_03_1061 + 23651404-23651625,23651764-23652954                       69   4e-12
08_02_0181 + 13923658-13923661,13925518-13925681,13925879-139259...    66   2e-11
11_06_0497 + 24337772-24337993,24338042-24338083,24338176-24339357     64   9e-11
10_08_0338 + 16916429-16916650,16916728-16917900                       60   1e-09
01_07_0160 - 41563109-41563468,41563566-41563985,41564082-415642...    58   8e-09
01_06_1533 + 38041499-38041681,38041853-38041985,38042816-380429...    53   2e-07
03_06_0105 + 31675083-31675313,31676171-31676815                       52   5e-07
05_04_0101 - 18003528-18003655,18003951-18003997,18004046-180040...    51   1e-06
07_01_0182 + 1280479-1280754,1281232-1282089                           50   2e-06
01_07_0243 + 42240553-42240750,42241114-42241255,42242327-42242442     47   1e-05
06_03_0794 - 24671955-24672362,24672469-24672505,24672804-246728...    47   2e-05
12_02_1219 + 27096477-27096590,27096704-27097078                       46   3e-05
03_05_0630 + 26260159-26260272,26260520-26260894                       45   6e-05
03_02_0346 - 7666500-7666646,7666744-7666902                           45   6e-05
01_06_1799 + 39948481-39948607,39948694-39948762,39948859-399489...    45   6e-05
01_05_0696 - 24366857-24368200                                         45   6e-05
03_06_0587 - 34921535-34922041,34922579-34922689                       45   8e-05
02_05_0796 + 31800256-31800528,31800635-31800758,31802642-318027...    45   8e-05
10_08_0254 + 16236689-16236793,16237760-16237808,16237988-162380...    44   1e-04
08_02_1559 - 27873345-27873407,27873549-27873830,27874162-278742...    44   1e-04
12_02_0450 + 19172812-19172920,19173020-19173088,19173168-191732...    43   2e-04
09_06_0308 - 22199389-22199451,22199604-22199924,22200178-222004...    43   2e-04
07_03_0824 + 21769569-21769689,21770891-21770959,21771047-217711...    43   2e-04
07_01_0628 - 4691991-4692806,4694291-4694293,4694527-4694637           43   2e-04
05_03_0022 + 7452234-7452389,7452955-7453113                           43   2e-04
04_04_0435 - 25170348-25170593,25170989-25171189,25171580-251717...    43   2e-04
01_06_0834 + 32302065-32302143,32303136-32303275,32303371-323034...    43   2e-04
10_05_0029 - 8319233-8319408,8319516-8319584,8319754-8319838,832...    42   4e-04
04_03_0876 + 20493213-20493339,20493574-20493642,20493745-20493890     42   4e-04
01_06_0833 + 32296957-32297256,32299257-32299895                       42   4e-04
05_03_0023 + 7457836-7457976,7458313-7458480                           42   7e-04
03_02_0613 - 9848514-9848539,9848942-9849200,9849326-9849365,984...    41   0.001
08_01_0268 - 2167639-2167764,2167887-2167937,2169126-2169167,216...    41   0.001
08_01_0118 + 947394-947885,948709-948810,948914-949219,949557-94...    41   0.001
06_01_0824 - 6219477-6219556,6220427-6220808,6221415-6221448,622...    41   0.001
01_04_0003 - 14989160-14989445,14989673-14989807,14991418-149915...    41   0.001
03_05_0702 - 26934736-26935551,26937494-26937538,26938484-26938594     40   0.002
03_03_0130 - 14699658-14699723,14699828-14700109,14700444-147005...    40   0.002
02_05_1015 + 33512023-33512359,33513550-33514082                       40   0.002
02_05_0506 + 29613307-29613601,29613641-29613678,29613679-296138...    40   0.002
08_01_0600 - 5262573-5262773,5262850-5262952,5263050-5263180,526...    40   0.002
08_01_0098 - 700443-700660,701112-701268,701586-701678,701763-70...    40   0.002
07_03_1316 + 25736931-25737206,25737276-25737329,25738036-257381...    40   0.002
04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066     40   0.002
02_05_1206 + 34941293-34941562,34942052-34942153,34942249-349425...    40   0.002
01_01_1143 - 9064210-9065682                                           40   0.002
06_03_1455 + 30264023-30264174,30265930-30266070,30266328-302664...    40   0.003
03_05_0067 - 20460206-20460703,20461255-20461530                       40   0.003
03_02_0558 - 9459745-9459980,9460089-9460157,9460630-9460846           40   0.003
02_05_1014 + 33510108-33510471,33510857-33511362                       40   0.003
09_04_0424 + 17444261-17444665,17445974-17446367,17447367-174474...    39   0.004
07_03_1378 + 26158233-26158562,26159075-26159176,26159551-261598...    39   0.004
07_03_1175 - 24555965-24556117,24557809-24558264,24558270-245584...    39   0.004
05_03_0025 + 7462272-7462412,7462865-7463032                           39   0.004
04_04_1627 - 34867557-34870095,34870159-34870391,34871274-34871276     39   0.004
03_06_0523 + 34499533-34499705,34499808-34499917,34500037-345002...    39   0.004
04_04_1294 - 32424762-32426309                                         39   0.005
03_02_0472 - 8737955-8738580,8738704-8738767,8739090-8739239,873...    39   0.005
01_07_0362 + 43063345-43063420,43064176-43064244,43064348-430644...    39   0.005
02_02_0387 - 9606744-9607475                                           38   0.007
10_01_0298 - 3094197-3094307,3095093-3095253,3095462-3095666,309...    38   0.009
08_02_0526 + 18184146-18184168,18184247-18184438,18184846-181849...    38   0.009
03_03_0117 - 14583102-14583186,14585202-14585336,14585440-145856...    38   0.009
03_02_0555 + 9431451-9431688,9432685-9432803,9432886-9433079,943...    38   0.009
11_06_0728 + 26717018-26717306,26717494-26717598,26717789-267178...    38   0.012
11_06_0490 - 24293218-24293373,24293454-24293521,24293845-242939...    38   0.012
11_01_0489 + 3776563-3776692,3776995-3777073,3777532-3777840,377...    38   0.012
08_02_0162 + 13464698-13464974,13465719-13465837,13465920-134665...    38   0.012
03_01_0525 + 3952095-3952217,3953131-3953614,3953695-3953750,395...    38   0.012
03_01_0293 - 2258647-2258754,2258861-2259085                           38   0.012
11_02_0073 - 8020401-8020512,8020594-8020679,8020761-8020921,802...    37   0.015
08_01_0620 - 5416197-5416225,5416333-5416652,5417144-5417235,541...    37   0.015
04_04_0053 + 22389227-22389613,22390528-22390981,22391618-223916...    37   0.015
07_03_1389 + 26212117-26212119,26212721-26212875,26213402-262134...    37   0.020
07_03_0600 + 19866757-19867218,19867920-19868429                       37   0.020
04_04_1223 + 31851545-31852609,31854314-31854773,31856201-318562...    37   0.020
03_03_0192 - 15308602-15308869,15309457-15309528,15310271-153103...    37   0.020
08_02_1064 - 24033941-24034127,24034432-24034476,24035355-240354...    36   0.027
04_04_1188 + 31579833-31579914,31580001-31580176,31580822-315809...    36   0.027
01_07_0120 + 41185884-41186127,41187228-41187310,41188596-411886...    36   0.027
09_01_0079 - 1159963-1160211,1160303-1160509,1160631-1160801,116...    36   0.035
08_02_0651 - 19714348-19714395,19715319-19715429,19715503-197155...    36   0.035
07_01_1143 - 10711023-10711884,10713603-10713826,10714253-107145...    36   0.035
01_07_0248 + 42261373-42261609,42261733-42261905,42261986-422620...    36   0.035
05_01_0041 + 281427-281549,281671-281730,281822-281868,282013-28...    36   0.047
09_02_0211 - 5817564-5817578,5817711-5818040,5818095-5818196,581...    35   0.062
04_04_0979 - 29862280-29862444,29862718-29862999,29863831-298639...    35   0.062
02_02_0284 - 8547126-8547187,8547306-8547395,8547810-8547861,854...    35   0.062
07_03_1586 - 27929947-27930056,27930143-27930286,27930377-279307...    35   0.082
04_04_0674 + 27173948-27174188,27174704-27175260,27175310-271753...    35   0.082
02_05_0627 + 30463452-30463774,30463841-30463956,30464125-304643...    35   0.082
06_03_1075 + 27399279-27399376,27399449-27399555,27400791-274008...    34   0.11 
05_04_0092 + 17851085-17851346,17852778-17852860,17853891-178539...    34   0.11 
12_02_0846 - 23623624-23623784,23624076-23624258,23624601-236246...    33   0.19 
10_08_0154 + 15266430-15266953,15267748-15267820,15267893-152679...    33   0.19 
06_03_1076 + 27409107-27409204,27409731-27409835,27409915-274100...    33   0.19 
03_05_0235 - 22214700-22214914,22218782-22219045,22219258-22219294     33   0.19 
11_06_0418 - 23317077-23317343,23317614-23317787,23317886-233179...    33   0.25 
03_01_0373 - 2904914-2904949,2905030-2905144,2906446-2906534,290...    33   0.25 
02_04_0289 + 21615745-21616155,21617417-21617870,21618162-216182...    33   0.25 
08_02_1176 + 24931728-24931877,24933175-24933275,24934410-249347...    33   0.33 
04_04_1121 - 31041629-31041793,31041891-31042022,31042255-310424...    33   0.33 
01_06_0006 - 25517892-25517935,25518156-25518276,25518598-255187...    33   0.33 
09_04_0716 + 19702100-19702250,19702366-19702463,19702527-197026...    32   0.44 
02_02_0008 + 6061508-6061624,6062468-6062566,6062636-6063039,606...    32   0.44 
11_06_0326 - 22382001-22383248                                         32   0.58 
10_01_0076 - 987092-987671,987747-987812,988201-988363,988467-98...    32   0.58 
02_04_0518 + 23601355-23602498,23603481-23603779                       32   0.58 
11_08_0081 - 28216179-28216381,28216590-28216657,28217131-282172...    31   0.76 
03_01_0160 + 1302366-1302731,1303318-1303364,1303455-1303800           31   0.76 
01_06_1775 - 39808794-39808919,39809021-39809127,39810594-39812178     31   0.76 
02_04_0661 - 24802868-24802921,24803004-24803089,24803178-248032...    31   1.0  
12_02_1265 - 27435096-27437675                                         31   1.3  
07_01_0413 - 3155080-3155274,3155628-3155933,3156062-3156163,315...    31   1.3  
05_04_0383 - 20801036-20801309,20801413-20801538,20801706-208017...    31   1.3  
05_01_0112 - 757514-758444,758525-758571,759074-759236,759861-76...    31   1.3  
03_06_0507 + 34404843-34404968,34405091-34405151,34405260-344052...    31   1.3  
01_01_0201 + 1746088-1747086,1748735-1748806,1750106-1750168,175...    31   1.3  
06_03_1263 + 28828048-28828347                                         30   1.8  
03_06_0337 + 33224333-33224479,33224603-33224663,33224740-332247...    30   1.8  
03_03_0042 + 14009649-14009866,14011342-14011419,14011791-140119...    29   3.1  
07_01_0577 - 4286048-4286186,4286600-4286660,4286957-4287089,428...    29   5.4  
03_05_0066 - 20455976-20456161,20456251-20456347,20456608-204567...    29   5.4  
12_02_0871 + 23865343-23866016,23866122-23866170,23866276-238663...    28   7.1  
02_01_0500 - 3623837-3624019,3624591-3624778,3625209-3626147,362...    28   7.1  
07_03_1339 + 25879246-25881154,25881502-25881696,25881777-258819...    28   9.4  

>02_02_0100 -
           6783821-6784339,6784815-6784984,6785062-6785164,
           6785291-6785454,6786781-6786821,6786933-6787129
          Length = 397

 Score = 79.0 bits (186), Expect = 4e-15
 Identities = 38/85 (44%), Positives = 54/85 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G I D V+MKD  TK  +GFGF+T+S   ++D+   +  H IDGR VE KR VPREE+ 
Sbjct: 89  YGAITDSVIMKDKHTKMPRGFGFVTFSDPSVIDKVLEDE-HVIDGRTVEVKRTVPREEMS 147

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +   T +K+FV GL   + E++L
Sbjct: 148 SKDGPKT-RKIFVGGLPSSLTEDEL 171



 Score = 51.6 bits (118), Expect = 7e-07
 Identities = 22/42 (52%), Positives = 29/42 (69%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           LRE+FS +G IV   ++ D  TG+ RGFGFV F+  D V+RV
Sbjct: 171 LREHFSPYGKIVEHQIMLDHSTGRSRGFGFVTFESEDSVERV 212



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 1/58 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPRE 425
           +G+IV+  +M D  T RS+GFGF+T+     V+      R   + G+ VE K+A P++
Sbjct: 178 YGKIVEHQIMLDHSTGRSRGFGFVTFESEDSVERVISEGRMRDLGGKQVEIKKAEPKK 235



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/48 (39%), Positives = 27/48 (56%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++F  +G I    ++ DK T   RGFGFV F D   +D+V L+  H I
Sbjct: 84  KHFEKYGAITDSVIMKDKHTKMPRGFGFVTFSDPSVIDKV-LEDEHVI 130



 Score = 30.3 bits (65), Expect = 1.8
 Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 2/35 (5%)
 Frame = +1

Query: 154 SGDDYEEP--EHTRKLFIGGLDYRTTDSSLKEFYE 252
           SGDD   P  + + K+F+GG+ + TT+ S  + +E
Sbjct: 53  SGDDGRAPGGDSSGKIFVGGVAWETTEESFSKHFE 87



 Score = 28.3 bits (60), Expect = 7.1
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +1

Query: 145 PSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           P E     + P+ TRK+F+GGL    T+  L+E +
Sbjct: 142 PREEMSSKDGPK-TRKIFVGGLPSSLTEDELREHF 175


>06_03_0500 +
           21470681-21470952,21471049-21471089,21472322-21472485,
           21472577-21472679,21472806-21472975,21473766-21474239
          Length = 407

 Score = 76.6 bits (180), Expect = 2e-14
 Identities = 37/86 (43%), Positives = 54/86 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G I D V+MKD  TK  +GFGF+T+S   ++D+   +  H IDGR VE KR VPREE+ 
Sbjct: 114 YGAISDSVIMKDKHTKMPRGFGFVTFSDPSVIDKVLQDE-HTIDGRTVEVKRTVPREEMS 172

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
             +   T +K+FV G+   + E+ L+
Sbjct: 173 SKDGPKT-RKIFVGGIPPSLTEDKLK 197



 Score = 51.2 bits (117), Expect = 9e-07
 Identities = 20/43 (46%), Positives = 32/43 (74%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           +L+E+FS++G +V   ++ D  TG+ RGFGFV F++ D V+RV
Sbjct: 195 KLKEHFSSYGKVVEHQIMLDHGTGRSRGFGFVTFENEDAVERV 237



 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 21/59 (35%), Positives = 37/59 (62%), Gaps = 1/59 (1%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN-NRPHKIDGRIVEPKRAVPRE 425
           ++G++V+  +M D  T RS+GFGF+T+     V+   +  R H + G+ VE K+A P++
Sbjct: 202 SYGKVVEHQIMLDHGTGRSRGFGFVTFENEDAVERVMSEGRMHDLAGKQVEIKKAEPKK 260



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 20/48 (41%), Positives = 27/48 (56%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++F  +G I    ++ DK T   RGFGFV F D   +D+V LQ  H I
Sbjct: 109 KHFEKYGAISDSVIMKDKHTKMPRGFGFVTFSDPSVIDKV-LQDEHTI 155



 Score = 28.3 bits (60), Expect = 7.1
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +1

Query: 145 PSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           P E     + P+ TRK+F+GG+    T+  LKE +
Sbjct: 167 PREEMSSKDGPK-TRKIFVGGIPPSLTEDKLKEHF 200


>08_02_1101 -
           24308433-24308978,24309195-24309364,24309443-24309542,
           24310337-24310500,24310960-24310996,24311222-24311262,
           24313877-24314093
          Length = 424

 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 35/86 (40%), Positives = 56/86 (65%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEIVD V+M+D  T + +GFGFITYS   +VD   ++  H+ +G+ VE KR +P++ ++
Sbjct: 108 YGEIVDSVIMRDKHTSQPRGFGFITYSNPAVVDRVMDD-IHEFNGKQVEIKRTIPKDSVQ 166

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
             +     KK+FV GL Q + E+D +
Sbjct: 167 SKDFK--TKKIFVGGLPQALTEDDFK 190



 Score = 51.6 bits (118), Expect = 7e-07
 Identities = 26/66 (39%), Positives = 40/66 (60%), Gaps = 1/66 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDE-AQNNRPHKIDGRIVEPKRAVPREEI 431
           +G +VD  +M+D +TKRS+GFGFI +S   +VD+   N     + G  VE K+A P++  
Sbjct: 196 YGPVVDHQIMRDHQTKRSRGFGFIVFSSDQVVDDLLANGNMIDLAGAKVEIKKAEPKKSS 255

Query: 432 KRPEAS 449
             P +S
Sbjct: 256 NPPPSS 261



 Score = 39.1 bits (87), Expect = 0.004
 Identities = 16/40 (40%), Positives = 25/40 (62%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           ++F  +G IV   ++ DK T + RGFGF+ + +   VDRV
Sbjct: 103 KHFGQYGEIVDSVIMRDKHTSQPRGFGFITYSNPAVVDRV 142



 Score = 35.5 bits (78), Expect = 0.047
 Identities = 14/46 (30%), Positives = 24/46 (52%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           + +F  +G +V   ++ D +T + RGFGF+ F     VD +    N
Sbjct: 190 KHFFQKYGPVVDHQIMRDHQTKRSRGFGFIVFSSDQVVDDLLANGN 235


>07_03_1061 + 23651404-23651625,23651764-23652954
          Length = 470

 Score = 68.9 bits (161), Expect = 4e-12
 Identities = 33/70 (47%), Positives = 46/70 (65%)
 Frame = +3

Query: 237 KRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAV 416
           +R    +G I DVVVM D  T+R +GFGFITY     VD+A +   H+++G++VE KRAV
Sbjct: 123 RRYFEQFGVITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALHKNFHELNGKMVEVKRAV 182

Query: 417 PREEIKRPEA 446
           P+E+   P A
Sbjct: 183 PKEQSPGPAA 192



 Score = 61.3 bits (142), Expect = 8e-10
 Identities = 33/93 (35%), Positives = 55/93 (59%), Gaps = 11/93 (11%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE-- 428
           +GE+ + V+M+D  T R++GFGF+ ++ A + +    ++ H IDGR+VE K+AVPR++  
Sbjct: 29  FGEVTEAVIMRDRNTGRARGFGFVVFTDAGVAERVTMDK-HMIDGRMVEAKKAVPRDDQS 87

Query: 429 ---------IKRPEASATVKKLFVAGLKQDIEE 500
                    I  P    T +K+FV GL  ++ E
Sbjct: 88  ITSKNNGSSIGSPGPGRT-RKIFVGGLASNVTE 119



 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 22/48 (45%), Positives = 31/48 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           RLREYFS FG +    ++ D+ TG+ RGFGFV F D    +RV + ++
Sbjct: 21  RLREYFSRFGEVTEAVIMRDRNTGRARGFGFVVFTDAGVAERVTMDKH 68



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 20/49 (40%), Positives = 28/49 (57%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           R YF  FG I  V V+ D  T + RGFGF+ +D  D VD+   +  H++
Sbjct: 123 RRYFEQFGVITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALHKNFHEL 171



 Score = 28.7 bits (61), Expect = 5.4
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = +1

Query: 175 PEHTRKLFIGGLDYRTTDSSLKEFYE 252
           P  TRK+F+GGL    T+   + ++E
Sbjct: 102 PGRTRKIFVGGLASNVTEVEFRRYFE 127


>08_02_0181 +
           13923658-13923661,13925518-13925681,13925879-13925978,
           13926072-13926244,13926486-13927016
          Length = 323

 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 34/86 (39%), Positives = 53/86 (61%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEIVD V+MKD  T++ +GFGFIT++   +VD    +  H I+G+ VE KR +P+    
Sbjct: 11  YGEIVDAVIMKDRFTQKPRGFGFITFADPAVVDRVIEDN-HVINGKEVEIKRTIPKG--A 67

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
            P      KK+FV GL   ++E++ +
Sbjct: 68  APLKDFKTKKIFVGGLPSALKEDEFK 93



 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 23/49 (46%), Positives = 31/49 (63%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +EYF  +G IV   ++ D+ T K RGFGF+ F D   VDRV ++ NH I
Sbjct: 5   KEYFGKYGEIVDAVIMKDRFTQKPRGFGFITFADPAVVDRV-IEDNHVI 52



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 19/49 (38%), Positives = 29/49 (59%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +E+FS FG +V   ++ D  T + RGFGFV FD    VD +  ++ + I
Sbjct: 93  KEFFSKFGKVVEHEIIRDHSTNRSRGFGFVVFDAEKTVDELLAKKGNMI 141



 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 2/67 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKID--GRIVEPKRAVPREE 428
           +G++V+  +++D  T RS+GFGF+ +     VDE    + + ID  G  VE K+A P++ 
Sbjct: 99  FGKVVEHEIIRDHSTNRSRGFGFVVFDAEKTVDELLAKKGNMIDLNGSQVEIKKAEPKKP 158

Query: 429 IKRPEAS 449
              P  S
Sbjct: 159 SNPPHRS 165


>11_06_0497 + 24337772-24337993,24338042-24338083,24338176-24339357
          Length = 481

 Score = 64.5 bits (150), Expect = 9e-11
 Identities = 32/68 (47%), Positives = 43/68 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G I DVVVM D  T+R +GFGFITY     VD+A     H+++G++VE KRAVP+E   
Sbjct: 143 FGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALFKTFHELNGKMVEVKRAVPKELSP 202

Query: 435 RPEASATV 458
            P   + V
Sbjct: 203 GPSMRSPV 210



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 20/48 (41%), Positives = 32/48 (66%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           RLREYF  +G +V   ++ D+ TG+ RGFGF+ F D    +RV ++++
Sbjct: 21  RLREYFDKYGEVVEAVIMRDRATGRARGFGFIVFADPAVAERVIMEKH 68



 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 35/108 (32%), Positives = 55/108 (50%), Gaps = 24/108 (22%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR-------------- 392
           +GE+V+ V+M+D  T R++GFGFI ++   + +     + H IDGR              
Sbjct: 29  YGEVVEAVIMRDRATGRARGFGFIVFADPAVAERVIMEK-HMIDGRMIHDDDDGVLDPSM 87

Query: 393 IVEPKRAVPREE---IKRPEASA-------TVKKLFVAGLKQDIEEED 506
           +VE K+AVPR++   + +   SA         KK+FV GL   + E D
Sbjct: 88  VVEAKKAVPRDDQHALSKSGGSAHGSPGPSRTKKIFVGGLASTVTEAD 135



 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 20/49 (40%), Positives = 29/49 (59%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           R+YF  FG I  V V+ D  T + RGFGF+ +D  D VD+   +  H++
Sbjct: 137 RKYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALFKTFHEL 185



 Score = 29.5 bits (63), Expect = 3.1
 Identities = 9/26 (34%), Positives = 18/26 (69%)
 Frame = +1

Query: 175 PEHTRKLFIGGLDYRTTDSSLKEFYE 252
           P  T+K+F+GGL    T++  ++++E
Sbjct: 116 PSRTKKIFVGGLASTVTEADFRKYFE 141



 Score = 28.3 bits (60), Expect = 7.1
 Identities = 11/25 (44%), Positives = 19/25 (76%), Gaps = 1/25 (4%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFYE-HGE 261
           KLFIGG+ + T +  L+E+++ +GE
Sbjct: 7   KLFIGGISWDTNEDRLREYFDKYGE 31


>10_08_0338 + 16916429-16916650,16916728-16917900
          Length = 464

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 27/57 (47%), Positives = 37/57 (64%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G + DVVVM D  T+R +GFGFIT+     VD   +   H + G++VE KRA+PRE
Sbjct: 151 YGVVTDVVVMYDQNTQRPRGFGFITFDAEDAVDRVLHKTFHDLSGKMVEVKRALPRE 207



 Score = 58.0 bits (134), Expect = 8e-09
 Identities = 28/66 (42%), Positives = 42/66 (63%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           A+G++    VM+D  T R +GFGF+ +S    VD A  + PH +DGR V+ KRA+ REE 
Sbjct: 28  AYGDVSQAAVMRDKLTGRPRGFGFVVFSDPSSVDAALVD-PHTLDGRTVDVKRALSREEQ 86

Query: 432 KRPEAS 449
           +  +A+
Sbjct: 87  QAAKAA 92



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 22/49 (44%), Positives = 31/49 (63%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           R+YF T+G +  V V+ D+ T + RGFGF+ FD  D VDRV  +  H +
Sbjct: 145 RQYFQTYGVVTDVVVMYDQNTQRPRGFGFITFDAEDAVDRVLHKTFHDL 193



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 19/41 (46%), Positives = 29/41 (70%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           +LR++F+ +G++   +V+ DK TG+ RGFGFV F D   VD
Sbjct: 21  KLRDHFAAYGDVSQAAVMRDKLTGRPRGFGFVVFSDPSSVD 61


>01_07_0160 -
           41563109-41563468,41563566-41563985,41564082-41564263,
           41564362-41564542,41565066-41565084,41565185-41565445,
           41566140-41566253,41566264-41566331,41566890-41567018,
           41567141-41567245,41567317-41567456,41567519-41567687,
           41567824-41567900,41568133-41568187,41568660-41568705,
           41568806-41568894,41568996-41569061,41569360-41569425,
           41569817-41569906,41570009-41570026
          Length = 884

 Score = 58.0 bits (134), Expect = 8e-09
 Identities = 32/84 (38%), Positives = 52/84 (61%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN--NRPHKIDGRIVEPKRAVPREE 428
           +G + D VVMK+  + RS+GFG++T+S A   D+A+N     H +  R +E K A P+EE
Sbjct: 26  FGPLDDCVVMKERSSGRSRGFGYVTFSSA---DDAKNVLECEHVLGNRTLEVKIATPKEE 82

Query: 429 IKRPEASATVKKLFVAGLKQDIEE 500
           +K  + S    ++FVA + Q ++E
Sbjct: 83  MK-SQGSKKATRIFVARIPQSVDE 105



 Score = 49.2 bits (112), Expect = 4e-06
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 1/64 (1%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR-EE 428
           A+GEI D+ + K+  +K  +G GFIT+  A  VD    +  H++DG  V   RA P+ EE
Sbjct: 114 AYGEITDLYMPKEHGSKGHRGIGFITFQSAESVDSIMQD-SHELDGTTVVVDRATPKDEE 172

Query: 429 IKRP 440
           ++ P
Sbjct: 173 VRYP 176



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 22/50 (44%), Positives = 28/50 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR YF  FG IV   +  D +    RGFGFV F D    DRV  +++H+I
Sbjct: 255 LRHYFGKFGRIVDAYIPKDPKRSGHRGFGFVTFADEGVADRVA-RRSHEI 303



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 22/57 (38%), Positives = 30/57 (52%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G IVD  + KDPK    +GFGF+T++   + D     R H+I G  V    A P E
Sbjct: 262 FGRIVDAYIPKDPKRSGHRGFGFVTFADEGVADRVA-RRSHEILGHEVAIDTAAPLE 317



 Score = 37.9 bits (84), Expect = 0.009
 Identities = 16/42 (38%), Positives = 23/42 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           LREY   FG +    V+ ++ +G+ RGFG+V F   D    V
Sbjct: 19  LREYMGKFGPLDDCVVMKERSSGRSRGFGYVTFSSADDAKNV 60


>01_06_1533 +
           38041499-38041681,38041853-38041985,38042816-38042954,
           38043331-38043367,38045606-38045897,38046384-38046502
          Length = 300

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 21/47 (44%), Positives = 30/47 (63%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637
           +  +R+YF  FG I+   V+TDK TG+ +G+GFV F D D   R C+
Sbjct: 29  KETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDPDAAMRACV 75



 Score = 39.1 bits (87), Expect = 0.004
 Identities = 19/46 (41%), Positives = 27/46 (58%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +GEI++ VV+ D  T RSKG+GF+T+        A  +    IDGR
Sbjct: 39  FGEILEAVVITDKNTGRSKGYGFVTFRDPDAAMRACVDPAPVIDGR 84


>03_06_0105 + 31675083-31675313,31676171-31676815
          Length = 291

 Score = 52.0 bits (119), Expect = 5e-07
 Identities = 25/56 (44%), Positives = 36/56 (64%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           +G I D VVM++  T R++GFGFI++     V +   NR H ++GR VE K AVP+
Sbjct: 135 FGTITDAVVMRNRTTNRARGFGFISFDSHEAVCKILLNRFHNLNGRDVEVKIAVPK 190



 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 18/50 (36%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L  YF  FG I    V+ ++ T + RGFGF+ FD ++ V ++ L + H +
Sbjct: 128 LISYFEKFGTITDAVVMRNRTTNRARGFGFISFDSHEAVCKILLNRFHNL 177



 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 18/35 (51%), Positives = 23/35 (65%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           LR +F+ +G +V   VV D  +G  RGFGFVEF D
Sbjct: 21  LRGHFARYGEVVHTRVVLDMASGNSRGFGFVEFAD 55



 Score = 37.1 bits (82), Expect = 0.015
 Identities = 32/103 (31%), Positives = 49/103 (47%), Gaps = 16/103 (15%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQ--AHMVDEAQNNRP-HKIDGRIVEPKRAVPRE 425
           +GE+V   V+ D  +  S+GFGF+ ++   A +   A +  P H   GR V+ KRA  R 
Sbjct: 28  YGEVVHTRVVLDMASGNSRGFGFVEFADEAATLRALADDEMPNHVFRGRKVDVKRAERRH 87

Query: 426 EIKRPEASAT-------------VKKLFVAGLKQDIEEEDLES 515
           + K+   S                KK+FV GL + +  +DL S
Sbjct: 88  DHKQTSPSIKNQNDSVQKNQFIFQKKVFVGGLHETVTVKDLIS 130


>05_04_0101 -
           18003528-18003655,18003951-18003997,18004046-18004077,
           18004316-18004453,18004579-18004619,18004967-18005105,
           18010981-18011057,18011804-18011858,18012976-18013021,
           18013099-18013187,18013304-18013417
          Length = 301

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 24/64 (37%), Positives = 39/64 (60%), Gaps = 1/64 (1%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR-EE 428
           A+GEI+D+ + K+ ++K  +G GFIT+  A  VD       H++DG  V   RA P+ E+
Sbjct: 72  AFGEIIDLYMPKELRSKSHRGIGFITFRSAECVDNIM-QETHELDGTTVAVDRATPKDED 130

Query: 429 IKRP 440
           ++ P
Sbjct: 131 VRHP 134



 Score = 35.5 bits (78), Expect = 0.047
 Identities = 14/51 (27%), Positives = 28/51 (54%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + R +F  FG I+ + +  +  +   RG GF+ F   + VD + +Q+ H++
Sbjct: 65  KFRRHFEAFGEIIDLYMPKELRSKSHRGIGFITFRSAECVDNI-MQETHEL 114


>07_01_0182 + 1280479-1280754,1281232-1282089
          Length = 377

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 22/58 (37%), Positives = 35/58 (60%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           ++G + DVVV+ D  T RS+GFGF+T+     V +   +  H + G  VE K A+P++
Sbjct: 166 SFGTVTDVVVIYDSMTNRSRGFGFVTFDSEEAVRKVIEHSFHDLKGTRVEAKIAIPKD 223



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 20/50 (40%), Positives = 28/50 (56%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           + YF +FG +  V V+ D  T + RGFGFV FD  + V +V     H +K
Sbjct: 161 KTYFESFGTVTDVVVIYDSMTNRSRGFGFVTFDSEEAVRKVIEHSFHDLK 210



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 22/48 (45%), Positives = 29/48 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           LR +F  +G + SV V+ DKETG  RGFGFVEF++ +   R      H
Sbjct: 36  LRGHFGQYGAVRSVIVMRDKETGHGRGFGFVEFEEEEDAARALGDGEH 83



 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 22/70 (31%), Positives = 40/70 (57%), Gaps = 4/70 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQ----AHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           +G +  V+VM+D +T   +GFGF+ + +    A  + + ++ R H I GR+V+ KRA  R
Sbjct: 43  YGAVRSVIVMRDKETGHGRGFGFVEFEEEEDAARALGDGEHPR-HLICGRVVDVKRARAR 101

Query: 423 EEIKRPEASA 452
            +    + S+
Sbjct: 102 PQRNHDDQSS 111


>01_07_0243 + 42240553-42240750,42241114-42241255,42242327-42242442
          Length = 151

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 18/43 (41%), Positives = 28/43 (65%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVC 634
           +R YF  FG+I+   V+TDK TG+ +G+GFV F + +   + C
Sbjct: 37  MRGYFEQFGDILEAVVITDKNTGRSKGYGFVTFREPEAAMKAC 79



 Score = 38.7 bits (86), Expect = 0.005
 Identities = 18/46 (39%), Positives = 29/46 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +G+I++ VV+ D  T RSKG+GF+T+ +     +A  +    IDGR
Sbjct: 44  FGDILEAVVITDKNTGRSKGYGFVTFREPEAAMKACFDPYPVIDGR 89


>06_03_0794 -
           24671955-24672362,24672469-24672505,24672804-24672858,
           24674044-24674167,24674670-24674903
          Length = 285

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 18/44 (40%), Positives = 27/44 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637
           LR +F  +G I+   V+TD+ TG+ +G+GFV F D D     C+
Sbjct: 49  LRAHFEAYGEILEAVVITDRATGRSKGYGFVTFRDPDSARMACM 92



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 20/47 (42%), Positives = 28/47 (59%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           A+GEI++ VV+ D  T RSKG+GF+T+        A  +    IDGR
Sbjct: 55  AYGEILEAVVITDRATGRSKGYGFVTFRDPDSARMACMDPYPVIDGR 101


>12_02_1219 + 27096477-27096590,27096704-27097078
          Length = 162

 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 19/35 (54%), Positives = 24/35 (68%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           R L   FSTFG I+   ++ D+ETG+ RGFGFV F
Sbjct: 22  RSLEAAFSTFGEILESKIINDRETGRSRGFGFVTF 56



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           +GEI++  ++ D +T RS+GFGF+T+ S+  M D  +     ++DGR +    A  R
Sbjct: 31  FGEILESKIINDRETGRSRGFGFVTFSSEQAMRDAIEGMNGKELDGRNITVNEAQSR 87


>03_05_0630 + 26260159-26260272,26260520-26260894
          Length = 162

 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 18/35 (51%), Positives = 24/35 (68%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           R L   FST+G I+   ++ D+ETG+ RGFGFV F
Sbjct: 22  RSLEAAFSTYGEILDSKIINDRETGRSRGFGFVTF 56



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           +GEI+D  ++ D +T RS+GFGF+T+ S+  M D  +     ++DGR +    A  R
Sbjct: 31  YGEILDSKIINDRETGRSRGFGFVTFSSEQSMRDAIEGMNGKELDGRNITVNEAQSR 87


>03_02_0346 - 7666500-7666646,7666744-7666902
          Length = 101

 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 19/41 (46%), Positives = 25/41 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           +R +F  FG IV   V+ DK TG+ +G+GFV F D D   R
Sbjct: 24  VRRHFEQFGEIVEAVVIADKHTGRSKGYGFVTFRDPDGAAR 64



 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 21/53 (39%), Positives = 30/53 (56%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           ++R    +GEIV+ VV+ D  T RSKG+GF+T+        A  +    IDGR
Sbjct: 24  VRRHFEQFGEIVEAVVIADKHTGRSKGYGFVTFRDPDGAARALQDPTPVIDGR 76


>01_06_1799 +
           39948481-39948607,39948694-39948762,39948859-39948965,
           39949257-39949406
          Length = 150

 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 17/37 (45%), Positives = 27/37 (72%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L+E F++FG++    V+ D+E+G+ RGFGFV F + D
Sbjct: 53  LKEAFTSFGDVTEARVINDRESGRSRGFGFVSFANGD 89



 Score = 32.3 bits (70), Expect = 0.44
 Identities = 14/56 (25%), Positives = 32/56 (57%), Gaps = 1/56 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIV 398
           +K    ++G++ +  V+ D ++ RS+GFGF++++       A +    K ++GR +
Sbjct: 53  LKEAFTSFGDVTEARVINDRESGRSRGFGFVSFANGDDAKSAMDAMDGKELEGRSI 108



 Score = 30.7 bits (66), Expect = 1.3
 Identities = 12/20 (60%), Positives = 15/20 (75%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFY 249
           KLF+GGL + T D SLKE +
Sbjct: 38  KLFVGGLSWNTNDDSLKEAF 57


>01_05_0696 - 24366857-24368200
          Length = 447

 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 30/102 (29%), Positives = 48/102 (47%), Gaps = 10/102 (9%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           ++ I  A+G++ + VV+ D  T RSKG+GF+T+  A     A      KIDGR+   + A
Sbjct: 92  LRAIFSAFGDLEEAVVITDKSTGRSKGYGFVTFRHADSAVLALKEPSKKIDGRMTVTQLA 151

Query: 414 V----------PREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
                             P A  +++K+FV  +  D+  E L
Sbjct: 152 AAGAAGGASGGAAGAGGAPAADVSLRKIFVGNVPADMPSERL 193



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 18/37 (48%), Positives = 24/37 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           LR  FS FG++    V+TDK TG+ +G+GFV F   D
Sbjct: 92  LRAIFSAFGDLEEAVVITDKSTGRSKGYGFVTFRHAD 128



 Score = 28.7 bits (61), Expect = 5.4
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGF 589
           RL  +F+ +G I    +  DK+TGK RGF
Sbjct: 192 RLLAHFAAYGEIEEGPLGFDKQTGKFRGF 220


>03_06_0587 - 34921535-34922041,34922579-34922689
          Length = 205

 Score = 44.8 bits (101), Expect = 8e-05
 Identities = 18/35 (51%), Positives = 24/35 (68%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L++ F  FGN+    VV DK +G+ RGFGFV FD+
Sbjct: 23  LKDAFGKFGNLTEAKVVFDKYSGRSRGFGFVTFDE 57



 Score = 35.9 bits (79), Expect = 0.035
 Identities = 16/57 (28%), Positives = 33/57 (57%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPR 422
           +G + +  V+ D  + RS+GFGF+T+ +   +++A +      +DGR +   +A P+
Sbjct: 30  FGNLTEAKVVFDKYSGRSRGFGFVTFDEKKAMEDAIEGMNGLDLDGRAITVDKAQPQ 86


>02_05_0796 +
           31800256-31800528,31800635-31800758,31802642-31802771,
           31804336-31804414,31804848-31805133,31805273-31805385
          Length = 334

 Score = 44.8 bits (101), Expect = 8e-05
 Identities = 20/46 (43%), Positives = 29/46 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +GEI++ VV+ D +T RSKG+GF+T+ +     EA  N    I GR
Sbjct: 69  YGEILEAVVITDRETSRSKGYGFVTFREPESAREAVRNPNPTIGGR 114



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 14/33 (42%), Positives = 24/33 (72%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L+++F  +G I+   V+TD+ET + +G+GFV F
Sbjct: 62  LQDHFQQYGEILEAVVITDRETSRSKGYGFVTF 94


>10_08_0254 +
           16236689-16236793,16237760-16237808,16237988-16238076,
           16238178-16238234,16238684-16238746,16238828-16238893,
           16239520-16239606,16239691-16239784,16240351-16240673,
           16241022-16241048,16241065-16241145,16241445-16241476,
           16242126-16242266,16242455-16242516,16243170-16243387
          Length = 497

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVS-VSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           L + FS FG IV+   ++ D ETG  RGFGFV +D ++  D+     N+Q
Sbjct: 128 LYDTFSAFGVIVTNPKIMRDPETGNSRGFGFVSYDSFESSDQAIEAMNNQ 177



 Score = 35.9 bits (79), Expect = 0.035
 Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 4/44 (9%)
 Frame = +3

Query: 252 AWGEIV-DVVVMKDPKTKRSKGFGFITYSQAHMVD---EAQNNR 371
           A+G IV +  +M+DP+T  S+GFGF++Y      D   EA NN+
Sbjct: 134 AFGVIVTNPKIMRDPETGNSRGFGFVSYDSFESSDQAIEAMNNQ 177



 Score = 31.9 bits (69), Expect = 0.58
 Identities = 16/40 (40%), Positives = 22/40 (55%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           L E F   G +V+V V  D+ T   +G+GFVEF   +  D
Sbjct: 41  LWELFVQAGPVVNVYVPKDRVTNLHQGYGFVEFRSEEDAD 80


>08_02_1559 -
           27873345-27873407,27873549-27873830,27874162-27874263,
           27874402-27874872
          Length = 305

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 19/41 (46%), Positives = 27/41 (65%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           RL + FS  G +V+ SVV D+E+G+ RGFGFV     + +D
Sbjct: 236 RLLQLFSEHGEVVNASVVYDRESGRSRGFGFVSMASKEELD 276



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 26/86 (30%), Positives = 47/86 (54%), Gaps = 4/86 (4%)
 Frame = +3

Query: 264 IVDVV-VMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPR-EEIK 434
           +V+V  V+ + +T +S+GFGF+T S     D+A +    + I+GR++   RA PR   ++
Sbjct: 152 VVEVAEVIYNRETGQSRGFGFVTMSTIEEADKAIEMLNRYDINGRLLNVNRAAPRGSRVE 211

Query: 435 RPEAS-ATVKKLFVAGLKQDIEEEDL 509
           RP    A   + +V  L   +++  L
Sbjct: 212 RPPRQFAPAFRAYVGNLPWQVDDSRL 237



 Score = 35.1 bits (77), Expect = 0.062
 Identities = 18/58 (31%), Positives = 34/58 (58%), Gaps = 1/58 (1%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRP-HKIDGRIVEPKRAVPREE 428
           GE+V+  V+ D ++ RS+GFGF++ +    +D+A +     ++DGR +    A  R +
Sbjct: 245 GEVVNASVVYDRESGRSRGFGFVSMASKEELDDAISALDGQELDGRPLRVNVAAERPQ 302



 Score = 33.5 bits (73), Expect = 0.19
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           L + F   G +    V+ ++ETG+ RGFGFV     +  D+
Sbjct: 143 LAQLFEQAGVVEVAEVIYNRETGQSRGFGFVTMSTIEEADK 183


>12_02_0450 +
           19172812-19172920,19173020-19173088,19173168-19173274,
           19173874-19174365
          Length = 258

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 13/33 (39%), Positives = 24/33 (72%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           LR+ F+ +G ++   ++ D+ETG+ RGFGF+ +
Sbjct: 47  LRDTFANYGQVIEAKIINDRETGRSRGFGFITY 79



 Score = 39.1 bits (87), Expect = 0.004
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKRAVPR 422
           +G++++  ++ D +T RS+GFGFITY+ +     A      K +DGR +    A  R
Sbjct: 54  YGQVIEAKIINDRETGRSRGFGFITYASSEEASAAITALDGKDLDGRNIRVNTANER 110



 Score = 28.3 bits (60), Expect = 7.1
 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKE-FYEHGE 261
           KLF+GGL Y T + SL++ F  +G+
Sbjct: 32  KLFVGGLSYGTDEQSLRDTFANYGQ 56


>09_06_0308 - 22199389-22199451,22199604-22199924,22200178-22200423,
            22202152-22203337,22203487-22203551,22204205-22204486,
            22205005-22205106,22205587-22206105
          Length = 927

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 21/53 (39%), Positives = 28/53 (52%)
 Frame = +2

Query: 497  RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
            R RL ++F   G ++   VV D++TG+ RGFGFV        D V    N QI
Sbjct: 856  RLRLLKFFGEHGRVLVAQVVCDRQTGRSRGFGFVSMATLREPDDVIASLNGQI 908



 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 19/41 (46%), Positives = 25/41 (60%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           RL + FS  G +V   VV D+ETG+ RGFGFV     + +D
Sbjct: 252 RLVQLFSEHGKVVDARVVYDRETGRSRGFGFVTMATQEELD 292



 Score = 39.1 bits (87), Expect = 0.004
 Identities = 25/86 (29%), Positives = 47/86 (54%), Gaps = 4/86 (4%)
 Frame = +3

Query: 264 IVDVV-VMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPR-EEIK 434
           IV+V  V+ + +T RS+GFGF+T S     ++A +    + +DGR++   +A PR   ++
Sbjct: 168 IVEVSEVIYNRETDRSRGFGFVTMSTVEEAEKAVEMFHRYDVDGRLLTVNKAAPRGARVE 227

Query: 435 RPEAS-ATVKKLFVAGLKQDIEEEDL 509
           RP        +++V  L   +++  L
Sbjct: 228 RPPRQFGPSFRIYVGNLPWQVDDSRL 253



 Score = 36.3 bits (80), Expect = 0.027
 Identities = 15/34 (44%), Positives = 24/34 (70%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           G++VD  V+ D +T RS+GFGF+T +    +D+A
Sbjct: 261 GKVVDARVVYDRETGRSRGFGFVTMATQEELDDA 294



 Score = 30.7 bits (66), Expect = 1.3
 Identities = 13/42 (30%), Positives = 22/42 (52%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           RL + F   G +    V+ ++ET + RGFGFV     +  ++
Sbjct: 158 RLAQLFEQAGIVEVSEVIYNRETDRSRGFGFVTMSTVEEAEK 199


>07_03_0824 +
           21769569-21769689,21770891-21770959,21771047-21771153,
           21771310-21771414
          Length = 133

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 17/33 (51%), Positives = 24/33 (72%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           LRE FS FG ++   V+TD+ +G  RGFGFV++
Sbjct: 51  LREAFSKFGQVIEARVITDRISGYSRGFGFVKY 83



 Score = 31.5 bits (68), Expect = 0.76
 Identities = 17/68 (25%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKRAVPREEI 431
           +G++++  V+ D  +  S+GFGF+ Y+      E       K +DG ++  + A  RE  
Sbjct: 58  FGQVIEARVITDRISGYSRGFGFVKYATVEEAGEGIKGMDGKFLDGWVIFAEYAKQREAQ 117

Query: 432 KRPEASAT 455
           +  + +A+
Sbjct: 118 QPAQPAAS 125


>07_01_0628 - 4691991-4692806,4694291-4694293,4694527-4694637
          Length = 309

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 21/65 (32%), Positives = 40/65 (61%), Gaps = 2/65 (3%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDV-VVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPK 407
           ++R    +G++++  +V+ +  T RS+GFGF+T+S+   VD A +     ++DGR +   
Sbjct: 23  LERAFSEYGKVIETQMVVLERDTGRSRGFGFVTFSEPRAVDAAIRGMHNGELDGRTISVN 82

Query: 408 RAVPR 422
           +A PR
Sbjct: 83  KAQPR 87



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 1/43 (2%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVS-VVTDKETGKKRGFGFVEFDDYDPVD 625
           R L   FS +G ++    VV +++TG+ RGFGFV F +   VD
Sbjct: 21  RTLERAFSEYGKVIETQMVVLERDTGRSRGFGFVTFSEPRAVD 63


>05_03_0022 + 7452234-7452389,7452955-7453113
          Length = 104

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/37 (51%), Positives = 25/37 (67%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           R L++ FS +G  VS  +  D+ETG+ RGFGFV F D
Sbjct: 37  RSLKDSFSNYG-AVSSEIAVDRETGRSRGFGFVSFQD 72



 Score = 30.3 bits (65), Expect = 1.8
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = +3

Query: 288 DPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPR 422
           D +T RS+GFGF+++  +    +A +      I GR V  + A PR
Sbjct: 56  DRETGRSRGFGFVSFQDSKSASDAIKGMNGQDIGGRNVIVQEAQPR 101


>04_04_0435 -
           25170348-25170593,25170989-25171189,25171580-25171756,
           25172284-25172418,25173131-25173262,25173292-25173369,
           25173452-25174108,25174210-25174328,25175897-25176173
          Length = 673

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/36 (52%), Positives = 26/36 (72%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L + FS FGNI+S  V TD E G+ +GFGFV++D
Sbjct: 141 KTLHDTFSAFGNILSCKVATD-EMGQSKGFGFVQYD 175



 Score = 33.1 bits (72), Expect = 0.25
 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 5/91 (5%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           A+G I+   V  D +  +SKGFGF+ Y +     EA  +    ++G ++  K       +
Sbjct: 149 AFGNILSCKVATD-EMGQSKGFGFVQYDKG----EAAQSAIKSLNGMLINDKPVYVGPFL 203

Query: 432 KRPEASATVKK-----LFVAGLKQDIEEEDL 509
           ++ E   +V K     +FV  L +   +EDL
Sbjct: 204 RKQERENSVDKTKFNNVFVKNLSESTTKEDL 234


>01_06_0834 +
           32302065-32302143,32303136-32303275,32303371-32303436,
           32303867-32303950,32304532-32304699,32305061-32305126,
           32306027-32306452
          Length = 342

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/49 (38%), Positives = 26/49 (53%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           +L+EYFS FG +    VVTD  T   RGFG ++F   +   R   +  H
Sbjct: 123 KLKEYFSNFGEVNRAIVVTDLNTKMPRGFGLIQFASEESTARALKKDRH 171



 Score = 30.7 bits (66), Expect = 1.3
 Identities = 15/49 (30%), Positives = 24/49 (48%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVE 401
           +GE+   +V+ D  TK  +GFG I ++       A     H + G+ VE
Sbjct: 131 FGEVNRAIVVTDLNTKMPRGFGLIQFASEESTARALKKDRHFLCGQWVE 179


>10_05_0029 -
           8319233-8319408,8319516-8319584,8319754-8319838,
           8320112-8320225
          Length = 147

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 15/37 (40%), Positives = 24/37 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L+E F+ +G ++   V+ D+ TG+ RGFGFV +   D
Sbjct: 77  LKEAFANYGEVIEARVIVDRTTGRSRGFGFVTYTSTD 113



 Score = 35.5 bits (78), Expect = 0.047
 Identities = 13/27 (48%), Positives = 21/27 (77%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYS 335
           +GE+++  V+ D  T RS+GFGF+TY+
Sbjct: 84  YGEVIEARVIVDRTTGRSRGFGFVTYT 110


>04_03_0876 + 20493213-20493339,20493574-20493642,20493745-20493890
          Length = 113

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 17/47 (36%), Positives = 29/47 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L E FS +G ++  ++VTDK T + +GFGFV+F   +  ++   + N
Sbjct: 53  LAEAFSQYGQVLEATIVTDKMTNRPKGFGFVKFASEEAANKAKEEMN 99



 Score = 34.3 bits (75), Expect = 0.11
 Identities = 13/46 (28%), Positives = 28/46 (60%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +G++++  ++ D  T R KGFGF+ ++     +EA N    +++G+
Sbjct: 60  YGQVLEATIVTDKMTNRPKGFGFVKFAS----EEAANKAKEEMNGK 101


>01_06_0833 + 32296957-32297256,32299257-32299895
          Length = 312

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 18/50 (36%), Positives = 27/50 (54%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           ++L+EYF+ FG +    VV D  T   RGFGF++F   +   R   +  H
Sbjct: 138 KKLKEYFNKFGEVNRAIVVIDLNTKMPRGFGFIQFASEESTARALKKDKH 187



 Score = 38.7 bits (86), Expect = 0.005
 Identities = 17/37 (45%), Positives = 23/37 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           LR +FS FG +  V    +K+TG  RGF FV+F + D
Sbjct: 45  LRAHFSRFGTVAFVGAPKNKQTGAARGFAFVQFVNPD 81



 Score = 38.7 bits (86), Expect = 0.005
 Identities = 19/65 (29%), Positives = 33/65 (50%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +GE+   +V+ D  TK  +GFGFI ++       A     H + G+ VE   A
Sbjct: 140 LKEYFNKFGEVNRAIVVIDLNTKMPRGFGFIQFASEESTARALKKDKHFLCGQWVEVSLA 199

Query: 414 VPREE 428
           +P+++
Sbjct: 200 MPKQQ 204



 Score = 36.7 bits (81), Expect = 0.020
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = +1

Query: 130 ILNMKPSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           +  +KPS  G      +  RK+F+GGL    T+  LKE++
Sbjct: 105 LAQLKPSAGGPQLSPGDQKRKIFVGGLPVSATEKKLKEYF 144


>05_03_0023 + 7457836-7457976,7458313-7458480
          Length = 102

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 20/49 (40%), Positives = 28/49 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           L +YF+ +G I S  +  D E G+ RGFGFV F+D + V+      N Q
Sbjct: 34  LMDYFADYGAI-SAEIAWDSEMGRPRGFGFVNFEDNESVNAAIHGMNGQ 81


>03_02_0613 -
           9848514-9848539,9848942-9849200,9849326-9849365,
           9849952-9850117,9850228-9850756
          Length = 339

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 15/31 (48%), Positives = 24/31 (77%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598
           LRE+F  FG+I+   +++DK TG+ +G+GFV
Sbjct: 49  LREHFERFGDILEAVIISDKLTGRSKGYGFV 79



 Score = 32.3 bits (70), Expect = 0.44
 Identities = 12/36 (33%), Positives = 24/36 (66%)
 Frame = +3

Query: 222 HRFFIKRIL*AWGEIVDVVVMKDPKTKRSKGFGFIT 329
           H+  ++     +G+I++ V++ D  T RSKG+GF++
Sbjct: 45  HKDTLREHFERFGDILEAVIISDKLTGRSKGYGFVS 80


>08_01_0268 -
           2167639-2167764,2167887-2167937,2169126-2169167,
           2169343-2169449,2169536-2169604,2170542-2170665
          Length = 172

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 16/33 (48%), Positives = 23/33 (69%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L+E F+ FG ++   VVTD+ TG  +GFGFV +
Sbjct: 52  LKEAFAKFGEVIHARVVTDRVTGFSKGFGFVRY 84



 Score = 29.9 bits (64), Expect = 2.3
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYS 335
           +K     +GE++   V+ D  T  SKGFGF+ Y+
Sbjct: 52  LKEAFAKFGEVIHARVVTDRVTGFSKGFGFVRYA 85


>08_01_0118 +
           947394-947885,948709-948810,948914-949219,949557-949616
          Length = 319

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 19/57 (33%), Positives = 31/57 (54%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           + LREYFS  G +VS  ++TD++ G+ R +GF+ F   + ++      N      NI
Sbjct: 251 QELREYFSQCGTVVSTRLLTDRKGGRGRVYGFLSFASAEELEAALKLDNTHFHGRNI 307



 Score = 34.7 bits (76), Expect = 0.082
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598
           L E F  +G ++SV +  D ETG  RG GFV
Sbjct: 150 LYELFKPYGTVLSVEISRDPETGLSRGCGFV 180



 Score = 29.5 bits (63), Expect = 3.1
 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 1/47 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRP-HKIDGR 392
           +G ++ V + +DP+T  S+G GF+T         A N      +DGR
Sbjct: 157 YGTVLSVEISRDPETGLSRGCGFVTMRSLPEARTAMNALDGFDLDGR 203


>06_01_0824 -
           6219477-6219556,6220427-6220808,6221415-6221448,
           6222214-6222370,6224449-6224575,6224663-6224914
          Length = 343

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 20/53 (37%), Positives = 31/53 (58%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           ++R    +GEI++ VV+ D  T RSKG+GF+T+ +A     A  +    I GR
Sbjct: 55  LRRHFEQYGEILEAVVIADRLTGRSKGYGFVTFREAEAARRAVQDPNPMIAGR 107



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  +G I+   V+ D+ TG+ +G+GFV F + +   R     N  I
Sbjct: 55  LRRHFEQYGEILEAVVIADRLTGRSKGYGFVTFREAEAARRAVQDPNPMI 104


>01_04_0003 -
           14989160-14989445,14989673-14989807,14991418-14991508,
           14991571-14991712,14991924-14992403,14992610-14993548
          Length = 690

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 3/48 (6%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF---DDYDPVDRVC 634
           R L + FS +G + S  VV DK +G  RGFGF+     +D D   R C
Sbjct: 529 RDLEKKFSKYGRVTSARVVRDKRSGDSRGFGFLSLEKDEDADAAIRAC 576


>03_05_0702 - 26934736-26935551,26937494-26937538,26938484-26938594
          Length = 323

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 1/51 (1%)
 Frame = +3

Query: 273 VVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPR 422
           +++M +  T+R +GFGF+T+S    VD A +     ++DGR +   +A P+
Sbjct: 51  ILIMLERHTQRHRGFGFVTFSDPEAVDSAIKEMHCQELDGRTISVNKAEPK 101



 Score = 32.3 bits (70), Expect = 0.44
 Identities = 16/50 (32%), Positives = 30/50 (60%), Gaps = 3/50 (6%)
 Frame = +2

Query: 512 EYFSTF-GNIVS--VSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           ++F +F G+ V+  + ++ ++ T + RGFGFV F D + VD    + + Q
Sbjct: 37  QWFGSFCGSFVNQVILIMLERHTQRHRGFGFVTFSDPEAVDSAIKEMHCQ 86


>03_03_0130 -
           14699658-14699723,14699828-14700109,14700444-14700545,
           14701038-14701385
          Length = 265

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 19/46 (41%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRP-HKIDGR 392
           GE+++  V+ D ++ RS+GFGF+TY  A  V+ A +N     +DGR
Sbjct: 204 GEVLEAKVIYDRESGRSRGFGFVTYGSAEEVENAVSNLDGADMDGR 249



 Score = 37.5 bits (83), Expect = 0.012
 Identities = 19/51 (37%), Positives = 26/51 (50%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +L   F   G++  V V+ DK TG+ RGFGFV     + V+    Q N  I
Sbjct: 101 QLAGLFEQAGSVEMVEVIYDKLTGRSRGFGFVTMSSVEEVEAAVEQFNGYI 151



 Score = 37.5 bits (83), Expect = 0.012
 Identities = 15/40 (37%), Positives = 24/40 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           L   FS  G ++   V+ D+E+G+ RGFGFV +   + V+
Sbjct: 196 LANLFSGEGEVLEAKVIYDRESGRSRGFGFVTYGSAEEVE 235



 Score = 37.1 bits (82), Expect = 0.015
 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 3/87 (3%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRI--VEPKRAVPREE 428
           G +  V V+ D  T RS+GFGF+T S    V+ A +    + +DGR   V      PRE+
Sbjct: 110 GSVEMVEVIYDKLTGRSRGFGFVTMSSVEEVEAAVEQFNGYILDGRSLRVNSGPPPPREQ 169

Query: 429 IKRPEASATVKKLFVAGLKQDIEEEDL 509
             +        +++V  L   ++   L
Sbjct: 170 SSQRAPRGEANRVYVGNLSWGVDNAAL 196


>02_05_1015 + 33512023-33512359,33513550-33514082
          Length = 289

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 19/47 (40%), Positives = 26/47 (55%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L E F TFG +  V V  D++TG  RGFGFV F   +  ++   + N
Sbjct: 224 LLELFRTFGPVSRVYVAVDQKTGASRGFGFVNFVHREDAEKAISKLN 270



 Score = 29.5 bits (63), Expect = 3.1
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVPR 422
           +G +  V V  D KT  S+GFGF+ +      ++A +    +  D  I+  + A PR
Sbjct: 231 FGPVSRVYVAVDQKTGASRGFGFVNFVHREDAEKAISKLNGYGYDNLILRVEWATPR 287


>02_05_0506 +
           29613307-29613601,29613641-29613678,29613679-29613802,
           29614358-29614484,29614915-29615002,29615539-29615631,
           29616380-29616529
          Length = 304

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 14/32 (43%), Positives = 23/32 (71%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598
           RLR ++  FG I+   V+TD+ +G+ +G+GFV
Sbjct: 52  RLRRFYDRFGEILEAVVITDRHSGRSKGYGFV 83



 Score = 32.7 bits (71), Expect = 0.33
 Identities = 13/32 (40%), Positives = 23/32 (71%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFIT 329
           ++R    +GEI++ VV+ D  + RSKG+GF++
Sbjct: 53  LRRFYDRFGEILEAVVITDRHSGRSKGYGFVS 84



 Score = 29.1 bits (62), Expect = 4.1
 Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 1/27 (3%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFYEH-GEKL 267
           K+F+GGL + TT   L+ FY+  GE L
Sbjct: 38  KVFVGGLAWETTSERLRRFYDRFGEIL 64


>08_01_0600 -
           5262573-5262773,5262850-5262952,5263050-5263180,
           5263263-5263312,5265266-5265725,5266349-5266708
          Length = 434

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 16/43 (37%), Positives = 27/43 (62%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           F+  G + SV ++ DK+TG+ +G+GF+EF  +   +RV    N
Sbjct: 115 FAPTGELQSVKLIRDKQTGQLQGYGFIEFTSHAGAERVLQTYN 157



 Score = 33.9 bits (74), Expect = 0.14
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +2

Query: 506 LREYFST-FGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+E F   + ++    VVTDK T + +G+GFV+F D     R   + N  +
Sbjct: 201 LQETFRVHYPSVKGAKVVTDKMTMRSKGYGFVKFGDPSEQARAMTEMNGMV 251



 Score = 28.3 bits (60), Expect = 7.1
 Identities = 12/35 (34%), Positives = 17/35 (48%)
 Frame = +1

Query: 145 PSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           PS  G   +       +F+GGLD   TD  LK+ +
Sbjct: 275 PSAQGVQSDSDPSNTTIFVGGLDPSVTDDMLKQVF 309


>08_01_0098 -
           700443-700660,701112-701268,701586-701678,701763-702149,
           702755-702829,703486-703609,703693-703832,703904-703993,
           704254-704298,704917-705042,705138-705272,705966-706451,
           706539-706596,706728-706855,707209-707463
          Length = 838

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 14/50 (28%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +R +FS  G + ++ ++ DK T K RG  +V+F D + ++    +  H++
Sbjct: 689 IRRFFSDIGGVTAIRLLRDKFTKKSRGIAYVDFSDNEHLEAAIRKNKHKL 738



 Score = 36.7 bits (81), Expect = 0.020
 Identities = 21/89 (23%), Positives = 42/89 (47%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+R     G +  + +++D  TK+S+G  ++ +S    ++ A     HK+  + V   R+
Sbjct: 689 IRRFFSDIGGVTAIRLLRDKFTKKSRGIAYVDFSDNEHLEAAIRKNKHKLLAKKVSVARS 748

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEE 500
            P +  K  EA +  K    +G + +  E
Sbjct: 749 DPSKGKKNREAGSFSKDQATSGDRGETAE 777


>07_03_1316 +
           25736931-25737206,25737276-25737329,25738036-25738189,
           25740235-25740313,25740413-25740492,25740588-25740654,
           25741548-25741619,25742071-25742223,25742309-25742392,
           25742811-25742877
          Length = 361

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVE 401
           +GE+VD+ + +D +T  S+GF F+ Y      DEAQ     ++DGR+V+
Sbjct: 175 YGEVVDIYIPRDRRTGDSRGFAFVRYKYE---DEAQ-KAVDRLDGRVVD 219


>04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066
          Length = 646

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 16/43 (37%), Positives = 24/43 (55%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           FS FG IV   V+ D+ TG+ +G+GFV++ D    +      N
Sbjct: 327 FSQFGEIVMAKVIRDRITGQSKGYGFVKYSDVSQANAAIAAMN 369



 Score = 35.9 bits (79), Expect = 0.035
 Identities = 20/51 (39%), Positives = 32/51 (62%), Gaps = 3/51 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY---SQAHMVDEAQNNRPHKIDGRIV 398
           +GEIV   V++D  T +SKG+GF+ Y   SQA+    A N   + ++GR++
Sbjct: 330 FGEIVMAKVIRDRITGQSKGYGFVKYSDVSQANAAIAAMNG--YHLEGRVI 378


>02_05_1206 +
           34941293-34941562,34942052-34942153,34942249-34942521,
           34942863-34942913
          Length = 231

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 21/58 (36%), Positives = 28/58 (48%)
 Frame = +2

Query: 473 SWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           SWT        L E F   GN+V   V+ D ETG+ RG+GFV +   + +D      N
Sbjct: 159 SWTVTSE---MLTEMFQKCGNVVGARVLYDGETGRSRGYGFVCYSTKEEMDEALSSLN 213



 Score = 36.7 bits (81), Expect = 0.020
 Identities = 18/57 (31%), Positives = 34/57 (59%), Gaps = 1/57 (1%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVPRE 425
           G +V   V+ D +T RS+G+GF+ YS    +DEA ++    +++GR +    A+ ++
Sbjct: 175 GNVVGARVLYDGETGRSRGYGFVCYSTKEEMDEALSSLNGTELEGREIRVNLALGKK 231



 Score = 31.9 bits (69), Expect = 0.58
 Identities = 25/80 (31%), Positives = 35/80 (43%), Gaps = 1/80 (1%)
 Frame = +3

Query: 273 VVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKI-DGRIVEPKRAVPREEIKRPEAS 449
           V V+ D  T RS+GF F+T S     ++   N    +  GR +    A  + + K P   
Sbjct: 89  VEVLYDRATGRSRGFAFVTMSTIEDCEQVIKNLDGSLYSGRTMRVNFA-DKPKPKLPLYP 147

Query: 450 ATVKKLFVAGLKQDIEEEDL 509
            T  KLFV  L   +  E L
Sbjct: 148 ETEHKLFVGNLSWTVTSEML 167


>01_01_1143 - 9064210-9065682
          Length = 490

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 17/33 (51%), Positives = 23/33 (69%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L E FS +G I  + VVTD+ TGK +G+GF+ F
Sbjct: 172 LTEAFSAYGEIEDLRVVTDRATGKCKGYGFILF 204



 Score = 33.9 bits (74), Expect = 0.14
 Identities = 18/47 (38%), Positives = 25/47 (53%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           A+GEI D+ V+ D  T + KG+GFI +S+      A      KI  R
Sbjct: 178 AYGEIEDLRVVTDRATGKCKGYGFILFSRRSGARAALREPQKKIGNR 224



 Score = 32.7 bits (71), Expect = 0.33
 Identities = 16/51 (31%), Positives = 27/51 (52%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           ++L ++FS +G I    +  DK TGK +GF    +   D   +  LQ+ H+
Sbjct: 281 QKLLQFFSKYGEIEEGPLGLDKVTGKPKGFALFVYKTLDSAKK-ALQEPHK 330


>06_03_1455 +
           30264023-30264174,30265930-30266070,30266328-30266430,
           30266510-30266659,30267184-30267229,30267383-30267738
          Length = 315

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 24/81 (29%), Positives = 40/81 (49%)
 Frame = +2

Query: 410 SSSKGRD*KTRS*CHR*KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGF 589
           S S+ R+ +  +  H   +  +   +R   R L++YFS  G + S  VV +  T   RGF
Sbjct: 91  SRSRSREREPDAVNHGNTLYVTGLSSRVTERELKDYFSKEGRVTSCHVVLEPHTRVSRGF 150

Query: 590 GFVEFDDYDPVDRVCLQQNHQ 652
            FV  D  +  +R C++  +Q
Sbjct: 151 AFVTMDTVEDAER-CIKYLNQ 170


>03_05_0067 - 20460206-20460703,20461255-20461530
          Length = 257

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 15/46 (32%), Positives = 28/46 (60%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           FS  G ++S  ++ +K+TG+  G+GF+EF  +   ++V    N Q+
Sbjct: 87  FSQAGELISAKIIRNKQTGQPEGYGFIEFGSHAIAEQVLQGYNGQM 132



 Score = 37.9 bits (84), Expect = 0.009
 Identities = 15/42 (35%), Positives = 24/42 (57%)
 Frame = +2

Query: 527 FGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           + ++    VV D+ TG+ +G+GFV+F D D   R   + N Q
Sbjct: 184 YQSVKGAKVVFDRSTGRSKGYGFVKFGDLDEQTRAMTEMNGQ 225


>03_02_0558 - 9459745-9459980,9460089-9460157,9460630-9460846
          Length = 173

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 14/48 (29%), Positives = 28/48 (58%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           +L+  F+ FG ++   V+TD+ +G+ +GFGFV +   +  +    + N
Sbjct: 82  KLKNAFAPFGQLLEAKVITDRISGRSKGFGFVRYATLEEAENARQEMN 129



 Score = 38.7 bits (86), Expect = 0.005
 Identities = 20/70 (28%), Positives = 37/70 (52%), Gaps = 1/70 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKR 410
           +K     +G++++  V+ D  + RSKGFGF+ Y+     + A+     K +DG ++    
Sbjct: 83  LKNAFAPFGQLLEAKVITDRISGRSKGFGFVRYATLEEAENARQEMNAKFLDGWVIFVDP 142

Query: 411 AVPREEIKRP 440
           A PR++   P
Sbjct: 143 AKPRQQKPAP 152


>02_05_1014 + 33510108-33510471,33510857-33511362
          Length = 289

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 18/47 (38%), Positives = 25/47 (53%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LRE F +FG +    V  D  TG+ RGFGF+ F   +  +R   + N
Sbjct: 224 LRELFGSFGPLTRAYVALDHRTGESRGFGFLSFVYREDAERAIAKLN 270


>09_04_0424 +
           17444261-17444665,17445974-17446367,17447367-17447425,
           17447507-17447637,17447737-17447833,17447936-17448100
          Length = 416

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 15/42 (35%), Positives = 26/42 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           L   F   G +V++ V+ +K+TG+  G+GFVEF  +   ++V
Sbjct: 126 LHSCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKV 167



 Score = 32.7 bits (71), Expect = 0.33
 Identities = 12/35 (34%), Positives = 19/35 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L  +   + ++    VV D  TG+ +G+GFV F D
Sbjct: 220 LETFSKRYSSVKGAKVVIDANTGRSKGYGFVRFGD 254



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 21/77 (27%), Positives = 36/77 (46%)
 Frame = +3

Query: 279 VMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPEASATV 458
           V+ D  T RSKG+GF+ +      D  + +   +++G       + P     R +   T 
Sbjct: 235 VVIDANTGRSKGYGFVRFGD----DNEKTHAMTEMNG------TSGPTGSAARSDGDLTN 284

Query: 459 KKLFVAGLKQDIEEEDL 509
             +FV GL  ++ E+DL
Sbjct: 285 TTVFVGGLDPNVSEDDL 301



 Score = 28.7 bits (61), Expect = 5.4
 Identities = 12/29 (41%), Positives = 22/29 (75%), Gaps = 1/29 (3%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFIT-YSQA 341
           GE+V + V+++ +T +S+G+GF+  YS A
Sbjct: 134 GEVVAIKVIRNKQTGQSEGYGFVEFYSHA 162


>07_03_1378 +
           26158233-26158562,26159075-26159176,26159551-26159850,
           26160006-26160068
          Length = 264

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 19/46 (41%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGR 392
           G ++D  V+ D ++ RS+GFGF+TY  A  V+ A +N     +DGR
Sbjct: 204 GTVLDAKVIYDRESGRSRGFGFVTYGSAEEVNNAISNLDGVDLDGR 249



 Score = 37.9 bits (84), Expect = 0.009
 Identities = 15/40 (37%), Positives = 24/40 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           L   FS  G ++   V+ D+E+G+ RGFGFV +   + V+
Sbjct: 196 LENLFSEQGTVLDAKVIYDRESGRSRGFGFVTYGSAEEVN 235



 Score = 35.1 bits (77), Expect = 0.062
 Identities = 15/32 (46%), Positives = 21/32 (65%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598
           +L   F   G++  V VV D++TG+ RGFGFV
Sbjct: 95  QLAGLFEQAGSVEMVEVVYDRQTGRSRGFGFV 126



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 27/95 (28%), Positives = 42/95 (44%), Gaps = 9/95 (9%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGR--IVEPKRAVPREE 428
           G +  V V+ D +T RS+GFGF+T S A     A +    +   GR   V      PR++
Sbjct: 104 GSVEMVEVVYDRQTGRSRGFGFVTMSTAEEAGAAVEQFNGYTFQGRPLRVNSGPPPPRDD 163

Query: 429 I--KRPEASA----TVKKLFVAGLKQDIEEEDLES 515
              + P        +  KL+V  L   ++   LE+
Sbjct: 164 FAPRSPRGGGSNFDSSNKLYVGNLAWGVDNSTLEN 198


>07_03_1175 -
           24555965-24556117,24557809-24558264,24558270-24558436,
           24558468-24558756,24559620-24559726,24559841-24559909,
           24560001-24560109
          Length = 449

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 11/33 (33%), Positives = 25/33 (75%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L++ FS +G+++   ++ D++TGK +G+GF+ +
Sbjct: 47  LKDVFSHYGDVLEARIIIDRDTGKSKGYGFITY 79



 Score = 36.3 bits (80), Expect = 0.027
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 1/64 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKR 410
           +K +   +G++++  ++ D  T +SKG+GFITY+ +     A      K + GRIV    
Sbjct: 47  LKDVFSHYGDVLEARIIIDRDTGKSKGYGFITYTSSEEAAAAVTAMDGKDLQGRIVRVST 106

Query: 411 AVPR 422
           A  R
Sbjct: 107 ANDR 110



 Score = 33.5 bits (73), Expect = 0.19
 Identities = 12/22 (54%), Positives = 17/22 (77%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFYEH 255
           KLF+GGL Y T D++LK+ + H
Sbjct: 32  KLFVGGLSYATDDTTLKDVFSH 53


>05_03_0025 + 7462272-7462412,7462865-7463032
          Length = 102

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 19/51 (37%), Positives = 28/51 (54%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           R L++ F+ +G I S  +  D   G+ RGFGFV F+D + V+      N Q
Sbjct: 32  RSLKDSFANYGAI-SAEIAWDSVMGRSRGFGFVNFEDSESVNAAIQGMNGQ 81


>04_04_1627 - 34867557-34870095,34870159-34870391,34871274-34871276
          Length = 924

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQ-NNRPHKIDGRIVE 401
           +GE+ +  V KD  T  SKG+GF+ YS  H   EA  +     +DGR +E
Sbjct: 327 FGEVTNAKVAKDHTTGLSKGYGFVQYSSPHHAAEAVIHLNGRLVDGRKIE 376



 Score = 37.5 bits (83), Expect = 0.012
 Identities = 16/49 (32%), Positives = 25/49 (51%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           ++L E F  FG I    VV D +T   +G+GF++F D +   +     N
Sbjct: 431 KKLVELFLPFGKITHARVVADPDTFSAKGYGFIKFTDSESATKAIAAMN 479



 Score = 35.5 bits (78), Expect = 0.047
 Identities = 17/36 (47%), Positives = 22/36 (61%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +L E F  FG IV   VV D  TG  +G+GFV++ D
Sbjct: 224 KLIELFLPFGQIVRSRVVDDCFTGLSQGYGFVKYSD 259



 Score = 35.5 bits (78), Expect = 0.047
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           RL + F   G I    VV ++ TG  +GFGFV+F D
Sbjct: 715 RLIDLFLPCGQITQAKVVVERYTGVSKGFGFVKFAD 750



 Score = 33.1 bits (72), Expect = 0.25
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           RL   F  FG + +  V  D  TG  +G+GFV++
Sbjct: 319 RLIHLFLPFGEVTNAKVAKDHTTGLSKGYGFVQY 352



 Score = 31.5 bits (68), Expect = 0.76
 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 4/89 (4%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPK-RAVPREE 428
           +G+IV   V+ D  T  S+G+GF+ YS      EA +      ++G  ++ +    P  E
Sbjct: 232 FGQIVRSRVVDDCFTGLSQGYGFVKYSDPRCASEAIKRMNGRLVEGTALKVRVTGFPSSE 291

Query: 429 --IKRPEASATVKKLFVAGLKQDIEEEDL 509
              ++P     + KL+V  L   +  + L
Sbjct: 292 DNSQQPSKETDMAKLYVCNLSLSMNTDRL 320



 Score = 30.7 bits (66), Expect = 1.3
 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 1/53 (1%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRA 413
           G+I    V+ +  T  SKGFGF+ ++ A+    A  +   + +DG ++E + A
Sbjct: 724 GQITQAKVVVERYTGVSKGFGFVKFADAYSAAVALTHMNGYPLDGHVLEVRIA 776



 Score = 29.5 bits (63), Expect = 3.1
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           +G+I    V+ DP T  +KG+GFI ++ +    +A
Sbjct: 440 FGKITHARVVADPDTFSAKGYGFIKFTDSESATKA 474


>03_06_0523 +
           34499533-34499705,34499808-34499917,34500037-34500224,
           34500984-34501451
          Length = 312

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 14/31 (45%), Positives = 23/31 (74%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           F+ +G +V V++V DK TGK +GF F+ ++D
Sbjct: 56  FAQYGEVVDVNLVRDKGTGKSKGFAFLAYED 86



 Score = 38.7 bits (86), Expect = 0.005
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIV 398
           +GE+VDV +++D  T +SKGF F+ Y  Q   +    N    K+ GRIV
Sbjct: 59  YGEVVDVNLVRDKGTGKSKGFAFLAYEDQRSTILAVDNLNGAKVLGRIV 107


>04_04_1294 - 32424762-32426309
          Length = 515

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 15/33 (45%), Positives = 23/33 (69%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           LR  FS FG +    V++DK++G+ +G+GFV F
Sbjct: 130 LRSAFSRFGELEDCRVISDKQSGRSKGYGFVLF 162



 Score = 34.3 bits (75), Expect = 0.11
 Identities = 17/42 (40%), Positives = 21/42 (50%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           RL EYFS FG I    +  DK TGK +GF    +   +   R
Sbjct: 245 RLYEYFSQFGEIEEGPLGFDKTTGKPKGFALFVYKSVESARR 286



 Score = 32.3 bits (70), Expect = 0.44
 Identities = 15/47 (31%), Positives = 25/47 (53%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRI 395
           +GE+ D  V+ D ++ RSKG+GF+ +        A      +I GR+
Sbjct: 137 FGELEDCRVISDKQSGRSKGYGFVLFRSRRSALRALRRPQLQIGGRL 183



 Score = 27.9 bits (59), Expect = 9.4
 Identities = 15/66 (22%), Positives = 26/66 (39%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI +  +  D  T + KGF    Y        A        DG+++  ++A+      
Sbjct: 253 FGEIEEGPLGFDKTTGKPKGFALFVYKSVESARRALEEPTRNFDGKMLNVQKAIDGRTKN 312

Query: 435 RPEASA 452
            P  +A
Sbjct: 313 TPGMNA 318


>03_02_0472 -
           8737955-8738580,8738704-8738767,8739090-8739239,
           8739311-8739422,8739686-8739708
          Length = 324

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKI-DGRIVEPKRAVPR 422
           A GE++D  ++ DP T+ S+GFGF+T +     D         + +GR++  ++A  R
Sbjct: 42  AEGEVIDASIVLDPWTRESRGFGFVTMATVKEADLCIKYLDRSVLEGRVITVEKAKRR 99



 Score = 35.9 bits (79), Expect = 0.035
 Identities = 17/47 (36%), Positives = 26/47 (55%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQ 640
           R L ++FS  G ++  S+V D  T + RGFGFV        D +C++
Sbjct: 34  RDLEKHFSAEGEVIDASIVLDPWTRESRGFGFVTMATVKEAD-LCIK 79


>01_07_0362 +
           43063345-43063420,43064176-43064244,43064348-43064454,
           43064561-43064608
          Length = 99

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 16/37 (43%), Positives = 24/37 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L++ FS  G+I+ V V+    TGK +G+GFV+F   D
Sbjct: 36  LKDAFSQHGHIIQVKVICHPVTGKSKGYGFVKFASED 72



 Score = 32.3 bits (70), Expect = 0.44
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVE 401
           G I+ V V+  P T +SKG+GF+ ++     DEA     HK+ G +++
Sbjct: 44  GHIIQVKVICHPVTGKSKGYGFVKFASE---DEAA-AALHKMGGEVID 87


>02_02_0387 - 9606744-9607475
          Length = 243

 Score = 38.3 bits (85), Expect = 0.007
 Identities = 19/34 (55%), Positives = 22/34 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598
           R RLRE +S  G +V   VV DK  G+ RGFGFV
Sbjct: 151 RLRLREMYSEHGKVVQARVVYDKR-GRSRGFGFV 183


>10_01_0298 -
           3094197-3094307,3095093-3095253,3095462-3095666,
           3096349-3096534,3096616-3096756,3096843-3096959,
           3097046-3097456
          Length = 443

 Score = 37.9 bits (84), Expect = 0.009
 Identities = 15/28 (53%), Positives = 23/28 (82%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYS 335
           A+GEI +V +MKD +TK +KGF F+T++
Sbjct: 131 AFGEISEVRLMKDKETKENKGFAFVTFT 158



 Score = 35.5 bits (78), Expect = 0.047
 Identities = 17/41 (41%), Positives = 21/41 (51%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           L E    FG I  V ++ DKET + +GF FV F   D   R
Sbjct: 125 LHELCEAFGEISEVRLMKDKETKENKGFAFVTFTGKDGAQR 165


>08_02_0526 +
           18184146-18184168,18184247-18184438,18184846-18184954,
           18185071-18185220,18185973-18186136,18186273-18186359,
           18187083-18187137,18187911-18188333
          Length = 400

 Score = 37.9 bits (84), Expect = 0.009
 Identities = 19/49 (38%), Positives = 26/49 (53%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           L ++FS  G + S  VV D  T + RGF FV  D  D   R C++  H+
Sbjct: 99  LEKFFSKEGKVQSCHVVLDPRTKESRGFAFVTMDSVDDARR-CIKYLHR 146



 Score = 30.3 bits (65), Expect = 1.8
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQ 362
           G++    V+ DP+TK S+GF F+T      VD+A+
Sbjct: 107 GKVQSCHVVLDPRTKESRGFAFVTMDS---VDDAR 138


>03_03_0117 -
           14583102-14583186,14585202-14585336,14585440-14585604,
           14586168-14586245,14586796-14586941
          Length = 202

 Score = 37.9 bits (84), Expect = 0.009
 Identities = 17/40 (42%), Positives = 24/40 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           LR  F  FG +  + +  D  TG+ RGFGF+++  YDP D
Sbjct: 53  LRRPFGKFGRVKDIYLPRDYYTGEPRGFGFIQY--YDPED 90



 Score = 28.3 bits (60), Expect = 7.1
 Identities = 16/55 (29%), Positives = 32/55 (58%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIV 398
           ++R    +G + D+ + +D  T   +GFGFI Y   +  ++A + + H +DG+I+
Sbjct: 53  LRRPFGKFGRVKDIYLPRDYYTGEPRGFGFIQY---YDPEDAADAKYH-MDGQIL 103


>03_02_0555 +
           9431451-9431688,9432685-9432803,9432886-9433079,
           9433174-9433430,9433544-9433650,9433715-9433888,
           9434359-9434490,9434776-9434955,9435062-9435265
          Length = 534

 Score = 37.9 bits (84), Expect = 0.009
 Identities = 20/47 (42%), Positives = 28/47 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LRE F+ FGNI S  ++ D E G  +GFGFV ++   P +  C  +N
Sbjct: 323 LRERFNEFGNITSAKIMRD-EKGISKGFGFVCYN--TPEEAKCAMRN 366



 Score = 33.9 bits (74), Expect = 0.14
 Identities = 16/33 (48%), Positives = 22/33 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L+E F  FG+I+S  V  + E G  RG+GFV+F
Sbjct: 130 LQELFCKFGDILSCKVAKN-EDGTSRGYGFVQF 161



 Score = 31.5 bits (68), Expect = 0.76
 Identities = 13/37 (35%), Positives = 23/37 (62%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           FS +G ++SV ++  ++ G  +GFGFV F + +   R
Sbjct: 224 FSQYGLVISVKIMK-RDDGTSKGFGFVSFQNPESAKR 259



 Score = 29.9 bits (64), Expect = 2.3
 Identities = 15/42 (35%), Positives = 21/42 (50%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK 380
           +G I    +M+D K   SKGFGF+ Y+       A  N P +
Sbjct: 330 FGNITSAKIMRDEKGI-SKGFGFVCYNTPEEAKCAMRNTPRQ 370


>11_06_0728 +
           26717018-26717306,26717494-26717598,26717789-26717870,
           26717979-26718055,26719087-26719151,26719261-26719302,
           26719385-26719444,26719583-26720203,26720315-26720450,
           26720667-26720734,26720811-26720948
          Length = 560

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 15/48 (31%), Positives = 25/48 (52%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           ++RE   +FG +    +V D+ETG  +G+ F  + D +  D  C   N
Sbjct: 361 QVRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLNVTDIACAALN 408



 Score = 28.7 bits (61), Expect = 5.4
 Identities = 12/42 (28%), Positives = 24/42 (57%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           ++ +L ++G +    ++KD +T  SKG+ F  Y   ++ D A
Sbjct: 362 VRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLNVTDIA 403


>11_06_0490 -
           24293218-24293373,24293454-24293521,24293845-24293986,
           24294079-24294699,24294791-24294871,24295002-24295072,
           24296106-24296176,24296568-24296675,24296786-24297024,
           24297493-24297657
          Length = 573

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 15/48 (31%), Positives = 25/48 (52%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           ++RE   +FG +    +V D+ETG  +G+ F  + D +  D  C   N
Sbjct: 366 QVRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLNVTDIACAALN 413



 Score = 28.7 bits (61), Expect = 5.4
 Identities = 12/42 (28%), Positives = 24/42 (57%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           ++ +L ++G +    ++KD +T  SKG+ F  Y   ++ D A
Sbjct: 367 VRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLNVTDIA 408


>11_01_0489 +
           3776563-3776692,3776995-3777073,3777532-3777840,
           3778828-3778898,3778975-3779213,3779306-3779383,
           3779734-3780156,3780416-3780661,3780886-3780978,
           3781480-3781527
          Length = 571

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 15/27 (55%), Positives = 20/27 (74%)
 Frame = +2

Query: 530 GNIVSVSVVTDKETGKKRGFGFVEFDD 610
           G +VS  +V DKETGK +G+GF E+ D
Sbjct: 64  GPVVSFRLVIDKETGKPKGYGFCEYKD 90


>08_02_0162 +
           13464698-13464974,13465719-13465837,13465920-13466579,
           13466686-13466763,13466849-13466938,13467241-13467378,
           13467730-13467738
          Length = 456

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 16/36 (44%), Positives = 26/36 (72%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L + FS FGNI+S  V T+  +G+ +G+GFV+F+
Sbjct: 141 KALYDTFSVFGNILSCKVATEM-SGESKGYGFVQFE 175


>03_01_0525 +
           3952095-3952217,3953131-3953614,3953695-3953750,
           3953942-3954018,3954862-3954958,3955274-3955407,
           3955760-3955825,3955954-3956044
          Length = 375

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 17/48 (35%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = +2

Query: 506 LREYFS-TFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L+E F  ++ ++    VVTD  TG+ +G+GFV+F D +  +R   + N
Sbjct: 125 LQETFRVSYPSVKGAKVVTDPNTGRSKGYGFVKFADENEKNRAMTEMN 172



 Score = 32.3 bits (70), Expect = 0.44
 Identities = 13/43 (30%), Positives = 24/43 (55%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           F+  G + SV ++ +K T    G+GF+EF  ++  ++V    N
Sbjct: 36  FAHTGELQSVKIIRNKLTSLPEGYGFIEFISHEVAEKVLQTYN 78



 Score = 29.9 bits (64), Expect = 2.3
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = +3

Query: 279 VMKDPKTKRSKGFGFITYSQAHMVDEAQNNR 371
           V+ DP T RSKG+GF+ ++     DE + NR
Sbjct: 141 VVTDPNTGRSKGYGFVKFA-----DENEKNR 166


>03_01_0293 - 2258647-2258754,2258861-2259085
          Length = 110

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           LR +F  FG + SV +  D+ TG+  GF F++F
Sbjct: 23  LRRHFQLFGYVASVHMPIDRHTGRHHGFAFIQF 55


>11_02_0073 -
           8020401-8020512,8020594-8020679,8020761-8020921,
           8021196-8021400,8021664-8021697,8022352-8022422,
           8023363-8023542,8023625-8023765,8023859-8023975,
           8024074-8024469
          Length = 500

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/41 (41%), Positives = 23/41 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           LRE   +FG I  V ++ DKET + +GF FV F   +   R
Sbjct: 120 LRELCDSFGEIYEVRLMKDKETKENKGFAFVNFTAKEAAQR 160



 Score = 36.3 bits (80), Expect = 0.027
 Identities = 17/52 (32%), Positives = 32/52 (61%), Gaps = 3/52 (5%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYS---QAHMVDEAQNNRPHK 380
           ++ +  ++GEI +V +MKD +TK +KGF F+ ++    A    E  +++ HK
Sbjct: 120 LRELCDSFGEIYEVRLMKDKETKENKGFAFVNFTAKEAAQRAIEELHDKEHK 171


>08_01_0620 -
           5416197-5416225,5416333-5416652,5417144-5417235,
           5417304-5417394,5417489-5417577,5417812-5417929,
           5418007-5418098,5418180-5418215,5418323-5418403,
           5418510-5418617,5418809-5418901,5419045-5419146,
           5419345-5419449,5419526-5419612,5419952-5420227
          Length = 572

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 16/60 (26%), Positives = 29/60 (48%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM 676
           R  L  +F+  G I  VSV  D+ETG  +G  +++F D     +        +  +N+++
Sbjct: 428 RESLEGHFADCGEITRVSVPMDRETGASKGIAYIDFKDQASFSKALELSGSDLGGYNLYV 487



 Score = 33.5 bits (73), Expect = 0.19
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +++E+F   G ++SV + T  E G  RGFG V+F
Sbjct: 326 QVKEFFQEVGEVISVRLATH-EDGSSRGFGHVQF 358


>04_04_0053 +
           22389227-22389613,22390528-22390981,22391618-22391673,
           22391757-22391887,22391976-22392072,22393329-22393484
          Length = 426

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 13/41 (31%), Positives = 25/41 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           L   F   G +V++ V+ +++TG+  G+GFVEF  +   ++
Sbjct: 120 LHSCFGPSGEVVTIKVIRNRQTGQSEGYGFVEFYSHGSAEK 160



 Score = 33.1 bits (72), Expect = 0.25
 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%)
 Frame = +2

Query: 506 LREYFST-FGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L E F+  + ++    V+ D  TG+ RG+GFV F D +       + N
Sbjct: 213 LMELFANKYRSVKGAKVIIDANTGRSRGYGFVRFGDDNDKSHAMTEMN 260



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 26/87 (29%), Positives = 42/87 (48%), Gaps = 3/87 (3%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFIT-YSQAHMVDEAQNNRPHKIDG--RIVEPKRAVPREE 428
           GE+V + V+++ +T +S+G+GF+  YS        QN   H +    R  +   A     
Sbjct: 128 GEVVTIKVIRNRQTGQSEGYGFVEFYSHGSAEKALQNFTGHVMPNTDRPFKLNWASYSMG 187

Query: 429 IKRPEASATVKKLFVAGLKQDIEEEDL 509
            KR E  A+   +FV  L  D+ +E L
Sbjct: 188 EKRSEV-ASDYSIFVGDLAADVTDEML 213



 Score = 28.3 bits (60), Expect = 7.1
 Identities = 22/88 (25%), Positives = 43/88 (48%), Gaps = 11/88 (12%)
 Frame = +3

Query: 279 VMKDPKTKRSKGFGFITY----SQAHMVDEAQ----NNRPHKIDGRIVEPKRAVPREEIK 434
           V+ D  T RS+G+GF+ +     ++H + E      + RP +I      P+R+       
Sbjct: 229 VIIDANTGRSRGYGFVRFGDDNDKSHAMTEMNGAYCSTRPIRIGP--ATPRRSSGDSGSS 286

Query: 435 RP---EASATVKKLFVAGLKQDIEEEDL 509
            P   +  +T + ++V GL  ++ E++L
Sbjct: 287 TPGHSDGDSTNRTVYVGGLDPNVSEDEL 314


>07_03_1389 +
           26212117-26212119,26212721-26212875,26213402-26213479,
           26214211-26214375,26214453-26214554,26214661-26214786,
           26215454-26215490
          Length = 221

 Score = 36.7 bits (81), Expect = 0.020
 Identities = 17/40 (42%), Positives = 24/40 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           LR  F  FG +  + +  D  +G+ RGFGFV++  YDP D
Sbjct: 57  LRRPFGQFGRLKDIYIPRDYYSGEPRGFGFVQY--YDPDD 94


>07_03_0600 + 19866757-19867218,19867920-19868429
          Length = 323

 Score = 36.7 bits (81), Expect = 0.020
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = +2

Query: 506 LREYFST-FGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L E F T + ++    VV DK TG+ +G+GFV F D +   R   + N
Sbjct: 239 LEEAFKTSYPSVRGAKVVFDKVTGRSKGYGFVRFGDENEQTRAMTEMN 286



 Score = 32.3 bits (70), Expect = 0.44
 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%)
 Frame = +2

Query: 506 LREYFSTFGN-IVSVSVVTDKETGKKRGFGFVEFDDY 613
           L   F+  G  + SV V+ +K++G   G+GF+EF  +
Sbjct: 144 LSNAFAPMGQQVTSVKVIRNKQSGHSEGYGFIEFQSH 180


>04_04_1223 +
           31851545-31852609,31854314-31854773,31856201-31856250,
           31856333-31856463,31856569-31856665,31856759-31856950,
           31857121-31857123
          Length = 665

 Score = 36.7 bits (81), Expect = 0.020
 Identities = 15/40 (37%), Positives = 25/40 (62%)
 Frame = +2

Query: 536 IVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + SV ++ DK++G+ +G+GFVEF      DR+    N Q+
Sbjct: 356 VQSVKLIRDKQSGQLQGYGFVEFTSRAAADRILQTYNGQM 395



 Score = 33.1 bits (72), Expect = 0.25
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = +2

Query: 506 LREYFST-FGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L+E F   + ++    VVTDK T + +G+GFV+F D     R   + N
Sbjct: 436 LQETFRVHYPSVKGAKVVTDKMTMRSKGYGFVKFGDPTEQARAMTEMN 483



 Score = 29.5 bits (63), Expect = 3.1
 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 12/90 (13%)
 Frame = +3

Query: 279 VMKDPKTKRSKGFGFITY----SQAHMVDEAQ----NNRPHKI----DGRIVEPKRAVPR 422
           V+ D  T RSKG+GF+ +     QA  + E      ++RP +I    + +    +  VP 
Sbjct: 452 VVTDKMTMRSKGYGFVKFGDPTEQARAMTEMNGMLCSSRPMRIGPAANKKTTGVQERVPN 511

Query: 423 EEIKRPEASATVKKLFVAGLKQDIEEEDLE 512
            +  + E       +FV GL  ++ E+ L+
Sbjct: 512 AQGAQSENDPNNTTIFVGGLDPNVTEDVLK 541



 Score = 29.1 bits (62), Expect = 4.1
 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
 Frame = +1

Query: 145 PSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKE-FYEHGE 261
           P+  G   E   +   +F+GGLD   T+  LK+ F  +GE
Sbjct: 510 PNAQGAQSENDPNNTTIFVGGLDPNVTEDVLKQVFAPYGE 549


>03_03_0192 -
           15308602-15308869,15309457-15309528,15310271-15310337,
           15310449-15310528,15310636-15310714,15310815-15310890
          Length = 213

 Score = 36.7 bits (81), Expect = 0.020
 Identities = 19/48 (39%), Positives = 29/48 (60%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVE 401
           GE++D+ + +D +T  S+GF F+ Y      DEAQ     K+DGR V+
Sbjct: 40  GEVLDIRIPRDRRTGDSRGFAFVRYKYE---DEAQ-KAVDKLDGRTVD 83


>08_02_1064 -
           24033941-24034127,24034432-24034476,24035355-24035421,
           24035521-24035600,24035691-24035769,24035864-24035939
          Length = 177

 Score = 36.3 bits (80), Expect = 0.027
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVE 401
           +G++VDV + +D +T  S+GF F+ Y  A   +EAQ     ++DGR V+
Sbjct: 39  YGKVVDVFIPRDRRTGDSRGFAFVRYKYA---EEAQ-KAIDRLDGRNVD 83


>04_04_1188 +
           31579833-31579914,31580001-31580176,31580822-31580923,
           31581015-31581245,31581821-31581922,31582092-31582184,
           31582275-31582379,31582455-31582514,31582621-31582698,
           31582778-31582924,31583011-31583109,31583178-31583267,
           31583360-31583451,31583529-31583646,31583783-31583871,
           31583998-31584088,31584203-31584294,31584442-31584749,
           31584866-31584897
          Length = 728

 Score = 36.3 bits (80), Expect = 0.027
 Identities = 15/38 (39%), Positives = 22/38 (57%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           R  L E+F + G I  VS+  D ETG  +G  +++F D
Sbjct: 587 RNSLEEHFGSCGEITRVSIPKDYETGASKGMAYMDFAD 624



 Score = 28.3 bits (60), Expect = 7.1
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           + +++++F   G +V +   T  E G  RGFG VEF
Sbjct: 483 QEQVKQFFQEAGEVVDIRFSTF-EDGNFRGFGHVEF 517


>01_07_0120 +
           41185884-41186127,41187228-41187310,41188596-41188647,
           41188729-41188854,41188967-41189049,41189308-41189490,
           41189901-41190237,41190607-41190750,41190854-41190939,
           41191069-41191113
          Length = 460

 Score = 36.3 bits (80), Expect = 0.027
 Identities = 15/34 (44%), Positives = 19/34 (55%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           L   F  FG ++S  V  DK TG  + FGFV +D
Sbjct: 390 LSNAFQRFGRVLSAKVFVDKATGSSKCFGFVSYD 423



 Score = 28.3 bits (60), Expect = 7.1
 Identities = 25/85 (29%), Positives = 40/85 (47%), Gaps = 3/85 (3%)
 Frame = +3

Query: 264 IVD-VVVMKDPKTKRSKGFGFITYSQAHMVDEAQN--NRPHKIDGRIVEPKRAVPREEIK 434
           IVD V V+KD  TK S+G  F+        D+A N  +  H + G     +      E++
Sbjct: 65  IVDEVTVIKDKATKASRGCCFLICPSREEADKAVNAYHNKHTLPGASSPLQVKYADGELE 124

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           R E      KLF+  L +++ + +L
Sbjct: 125 RLE-----HKLFIGMLPKNVTDTEL 144


>09_01_0079 -
           1159963-1160211,1160303-1160509,1160631-1160801,
           1161732-1161869,1162184-1162273,1162354-1162431,
           1162510-1163166,1163245-1163363,1164305-1164584
          Length = 662

 Score = 35.9 bits (79), Expect = 0.035
 Identities = 15/36 (41%), Positives = 25/36 (69%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L + F  FGNI+S  V TD  +G+ +G+GFV+++
Sbjct: 142 KALYDTFCVFGNILSCKVATDA-SGESKGYGFVQYE 176


>08_02_0651 -
           19714348-19714395,19715319-19715429,19715503-19715572,
           19716081-19716178,19716272-19716319,19716391-19716446,
           19718191-19718314,19718417-19718506
          Length = 214

 Score = 35.9 bits (79), Expect = 0.035
 Identities = 12/51 (23%), Positives = 31/51 (60%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++ +F  FG +  + +  +++TGK + +GF+EF++ +    V  + N+ +
Sbjct: 69  QMQGFFQQFGTVKRLRIARNRKTGKSKHYGFIEFENPEVAKIVADEMNNYL 119


>07_01_1143 -
           10711023-10711884,10713603-10713826,10714253-10714522,
           10715071-10715175
          Length = 486

 Score = 35.9 bits (79), Expect = 0.035
 Identities = 16/31 (51%), Positives = 21/31 (67%), Gaps = 1/31 (3%)
 Frame = +1

Query: 172 EPEHTRKLFIGGLDYRTTDSSLK-EFYEHGE 261
           + E  R L+IGGLD R T+  L+ +FY HGE
Sbjct: 223 DDESIRTLYIGGLDSRVTEQDLRDQFYAHGE 253


>01_07_0248 + 42261373-42261609,42261733-42261905,42261986-42262058,
            42262148-42262282,42262352-42262562,42262886-42263034,
            42263169-42263267,42263821-42263989,42264176-42264308,
            42264600-42264694,42264774-42264882,42265136-42265295,
            42265433-42265594,42265814-42265985,42266254-42266402,
            42266914-42266951,42267779-42267839,42267913-42268155,
            42268233-42268315,42269521-42269609,42270449-42270495,
            42270576-42270656,42270737-42270899,42271077-42271267,
            42271691-42271762
          Length = 1097

 Score = 35.9 bits (79), Expect = 0.035
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = +2

Query: 506  LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637
            L+E F  FG +V+V +  D+     RG+G++EF      ++  L
Sbjct: 909  LKEIFGNFGEVVNVELSMDRMVNLPRGYGYIEFKKRTDAEKALL 952



 Score = 29.1 bits (62), Expect = 4.1
 Identities = 18/71 (25%), Positives = 35/71 (49%), Gaps = 2/71 (2%)
 Frame = +3

Query: 234  IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRP-HKIDGRIVEPK- 407
            +K I   +GE+V+V +  D      +G+G+I + +    ++A       +IDG +V+ + 
Sbjct: 909  LKEIFGNFGEVVNVELSMDRMVNLPRGYGYIEFKKRTDAEKALLYMDGGQIDGNVVKLRF 968

Query: 408  RAVPREEIKRP 440
               PR+    P
Sbjct: 969  TLAPRQRASSP 979


>05_01_0041 +
           281427-281549,281671-281730,281822-281868,282013-282089,
           285368-285440,286193-286281,286665-286711,286805-286885,
           287011-287179,287381-287600,287679-287744,288194-288310,
           288591-288628,288935-289032
          Length = 434

 Score = 35.5 bits (78), Expect = 0.047
 Identities = 14/44 (31%), Positives = 25/44 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637
           L+E F  +G +V+V +  D+     RG+G+VEF +    ++  L
Sbjct: 152 LKEIFENYGEVVNVELSMDRVVNLPRGYGYVEFKNRADAEKALL 195



 Score = 30.7 bits (66), Expect = 1.3
 Identities = 19/73 (26%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRP-HKIDGRIVEPKR 410
           +K I   +GE+V+V +  D      +G+G++ +      ++A       +IDG +V+ + 
Sbjct: 152 LKEIFENYGEVVNVELSMDRVVNLPRGYGYVEFKNRADAEKALLYLDGGQIDGNVVKVRF 211

Query: 411 AVPREEIKRPEAS 449
           A+P ++ +R  AS
Sbjct: 212 ALPPQQ-QRAAAS 223


>09_02_0211 -
           5817564-5817578,5817711-5818040,5818095-5818196,
           5818616-5818915
          Length = 248

 Score = 35.1 bits (77), Expect = 0.062
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           GE++   V + P T +SKG+GF+T+S    V  A
Sbjct: 204 GEVLSATVSRIPGTAKSKGYGFVTFSSEEEVQAA 237



 Score = 32.3 bits (70), Expect = 0.44
 Identities = 14/39 (35%), Positives = 22/39 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           L+ +FS  G ++S +V     T K +G+GFV F   + V
Sbjct: 196 LKNFFSEKGEVLSATVSRIPGTAKSKGYGFVTFSSEEEV 234



 Score = 29.1 bits (62), Expect = 4.1
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598
           L   F+  G +    V+ DK TG+ R FGFV
Sbjct: 86  LAAMFADHGTVERAEVMFDKYTGRSRRFGFV 116


>04_04_0979 -
           29862280-29862444,29862718-29862999,29863831-29863929,
           29864037-29864366
          Length = 291

 Score = 35.1 bits (77), Expect = 0.062
 Identities = 16/33 (48%), Positives = 22/33 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           ++E+FS F N +S  VV D  +GK  G+GFV F
Sbjct: 190 MKEFFSKF-NPLSAKVVFDSPSGKSAGYGFVSF 221


>02_02_0284 -
           8547126-8547187,8547306-8547395,8547810-8547861,
           8548209-8548284,8550513-8550632,8553334-8553423,
           8553842-8554024,8554125-8554185,8554437-8554477,
           8554563-8554727,8555699-8555776,8556137-8556282
          Length = 387

 Score = 35.1 bits (77), Expect = 0.062
 Identities = 19/38 (50%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF-DDYD 616
           LR  F  FG +  V +  D  TG+ RGF FVEF D YD
Sbjct: 53  LRVPFERFGPVRDVYLPKDYYTGEPRGFAFVEFVDPYD 90



 Score = 29.1 bits (62), Expect = 4.1
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 1/64 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKRAVPREEI 431
           +G + DV + KD  T   +GF F+ +   +   EAQ +   + + GR  E    +  E  
Sbjct: 60  FGPVRDVYLPKDYYTGEPRGFAFVEFVDPYDASEAQYHMNRQVVFGR--EITVVLAAESR 117

Query: 432 KRPE 443
           KRPE
Sbjct: 118 KRPE 121


>07_03_1586 -
           27929947-27930056,27930143-27930286,27930377-27930704,
           27931189-27931404,27932099-27932284,27932439-27932521,
           27932621-27932752,27932943-27932999,27933352-27933412,
           27933807-27933889,27933975-27934134
          Length = 519

 Score = 34.7 bits (76), Expect = 0.082
 Identities = 15/34 (44%), Positives = 19/34 (55%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           L   F  FG I+S  V  D+ TG  + FGFV +D
Sbjct: 456 LANLFQEFGRILSTKVFIDRATGVSKCFGFVSYD 489


>04_04_0674 +
           27173948-27174188,27174704-27175260,27175310-27175399,
           27175475-27175714,27175801-27176022,27176124-27176433,
           27176528-27176847,27176906-27177021,27177133-27177227,
           27177331-27177407,27177520-27177615
          Length = 787

 Score = 34.7 bits (76), Expect = 0.082
 Identities = 14/42 (33%), Positives = 25/42 (59%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           ++++    GEI +V +M +P TK++KGF F+ Y+       A
Sbjct: 206 LRKVFGEVGEITEVRLMMNPVTKKNKGFAFLRYATVEQARRA 247



 Score = 29.9 bits (64), Expect = 2.3
 Identities = 14/57 (24%), Positives = 25/57 (43%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM 676
           LR+ F   G I  V ++ +  T K +GF F+ +   +   R   +  +      IW+
Sbjct: 206 LRKVFGEVGEITEVRLMMNPVTKKNKGFAFLRYATVEQARRAVSELKNPSVGLKIWI 262


>02_05_0627 +
           30463452-30463774,30463841-30463956,30464125-30464371,
           30464458-30464555,30465216-30465284,30465752-30465820,
           30465913-30466028
          Length = 345

 Score = 34.7 bits (76), Expect = 0.082
 Identities = 12/35 (34%), Positives = 22/35 (62%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           + LR  F  FG +V V ++ DK + + +G+ F+E+
Sbjct: 293 KTLRAAFEPFGELVEVKIIMDKISKRSKGYAFIEY 327



 Score = 33.5 bits (73), Expect = 0.19
 Identities = 13/27 (48%), Positives = 21/27 (77%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYS 335
           +GE+V+V ++ D  +KRSKG+ FI Y+
Sbjct: 302 FGELVEVKIIMDKISKRSKGYAFIEYT 328


>06_03_1075 +
           27399279-27399376,27399449-27399555,27400791-27400898,
           27401763-27401860,27401983-27402033,27402137-27402228,
           27402360-27402459,27402765-27402884,27402977-27403045,
           27403299-27403345,27403428-27403483,27404760-27404800,
           27405155-27405260,27406728-27406860,27406937-27407357
          Length = 548

 Score = 34.3 bits (75), Expect = 0.11
 Identities = 13/37 (35%), Positives = 22/37 (59%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           FS FG++ S  ++ D +TG    F F+EF+  +  +R
Sbjct: 289 FSHFGSVTSAEIIRDYKTGDSLCFAFIEFEKKEACER 325


>05_04_0092 +
           17851085-17851346,17852778-17852860,17853891-17853942,
           17854054-17854179,17854291-17854373,17855127-17855309,
           17855731-17855947,17856156-17856299,17856375-17856446,
           17857166-17857230,17857517-17857584,17857968-17858007,
           17858843-17859013
          Length = 521

 Score = 34.3 bits (75), Expect = 0.11
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           F  FG ++S  V  DK TG  + FGF+ +D
Sbjct: 360 FQGFGRVLSAKVFVDKATGLSKCFGFISYD 389


>12_02_0846 -
           23623624-23623784,23624076-23624258,23624601-23624641,
           23624746-23624910,23625808-23625885,23626024-23626169
          Length = 257

 Score = 33.5 bits (73), Expect = 0.19
 Identities = 18/38 (47%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF-DDYD 616
           LR  F  FG +  V +  D  +G+ RGF FVEF D YD
Sbjct: 53  LRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDPYD 90


>10_08_0154 +
           15266430-15266953,15267748-15267820,15267893-15267949,
           15268248-15268303,15269584-15269797,15270497-15270538,
           15270661-15270735,15270820-15270903,15271880-15271944,
           15272436-15272655,15272820-15272908,15273326-15273440,
           15273519-15273554
          Length = 549

 Score = 33.5 bits (73), Expect = 0.19
 Identities = 27/90 (30%), Positives = 43/90 (47%), Gaps = 6/90 (6%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR--IVEP----KRAVP 419
           G++ DV ++ D  ++RSKG G+I +  A  V  A       + G+  +V+P    K  V 
Sbjct: 217 GKVRDVRLIMDRNSRRSKGVGYIEFYDAMSVPMAIALTGQVLLGQQVMVKPSEAEKNLVQ 276

Query: 420 REEIKRPEASATVKKLFVAGLKQDIEEEDL 509
                   AS   +KL+V  L  +I E+ L
Sbjct: 277 SNVASGGIASGGARKLYVGNLHSNITEDQL 306



 Score = 32.7 bits (71), Expect = 0.33
 Identities = 12/37 (32%), Positives = 23/37 (62%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           R + E+FS  G +  V ++ D+ + + +G G++EF D
Sbjct: 207 RDVYEFFSRAGKVRDVRLIMDRNSRRSKGVGYIEFYD 243


>06_03_1076 +
           27409107-27409204,27409731-27409835,27409915-27410032,
           27410180-27410230,27410328-27410419,27410558-27410657,
           27411018-27411137,27411227-27411295,27411468-27411514,
           27411597-27411652,27412293-27412333,27412570-27412675,
           27413891-27414023,27414096-27414645
          Length = 561

 Score = 33.5 bits (73), Expect = 0.19
 Identities = 12/44 (27%), Positives = 24/44 (54%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           FS FG + S  ++ D +TG    + F+EF+  +  +R   + ++
Sbjct: 259 FSRFGTVTSAEIIRDYKTGDSLCYAFIEFETKEACERAFFKMDN 302


>03_05_0235 - 22214700-22214914,22218782-22219045,22219258-22219294
          Length = 171

 Score = 33.5 bits (73), Expect = 0.19
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 1/64 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRP-HKIDGRIVEPKRAVPREEI 431
           +GEI DV    D  T++ + FGF+T+ +      A +N    ++ GR++    A P E I
Sbjct: 31  FGEIKDVKTPLDQATQKHRSFGFVTFLEREDAAAAMDNMDGAELFGRVLTVNYAFP-ERI 89

Query: 432 KRPE 443
           K  E
Sbjct: 90  KGGE 93



 Score = 29.9 bits (64), Expect = 2.3
 Identities = 15/33 (45%), Positives = 16/33 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L   F  FG I  V    D+ T K R FGFV F
Sbjct: 24  LHAAFVPFGEIKDVKTPLDQATQKHRSFGFVTF 56


>11_06_0418 -
           23317077-23317343,23317614-23317787,23317886-23317971,
           23318125-23318244,23318338-23318368,23318457-23318532,
           23318672-23318759,23318877-23318938,23319041-23319117,
           23319890-23319992,23320237-23320298,23321116-23321289,
           23322160-23322405
          Length = 521

 Score = 33.1 bits (72), Expect = 0.25
 Identities = 13/30 (43%), Positives = 20/30 (66%)
 Frame = +2

Query: 515 YFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +F+ F +     V+ D++TG+ RGFGFV F
Sbjct: 263 FFAGFTSCSDARVMWDQKTGRSRGFGFVSF 292



 Score = 30.7 bits (66), Expect = 1.3
 Identities = 14/32 (43%), Positives = 18/32 (56%)
 Frame = +3

Query: 270 DVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN 365
           D  VM D KT RS+GFGF+++        A N
Sbjct: 272 DARVMWDQKTGRSRGFGFVSFRNQQDAQNAIN 303


>03_01_0373 -
           2904914-2904949,2905030-2905144,2906446-2906534,
           2906670-2906889,2907921-2907985,2908619-2908879,
           2909204-2909417,2910643-2910698,2910891-2910947,
           2911043-2911115,2912711-2913225
          Length = 566

 Score = 33.1 bits (72), Expect = 0.25
 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 6/90 (6%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR--IVEP----KRAVP 419
           G++ DV ++ D  ++RSKG G+I +     V  A       + G+  +V+P    K  V 
Sbjct: 214 GKVRDVRLIMDRNSRRSKGVGYIEFYDVMSVPMAIALSGQLLLGQQVMVKPSEAEKNLVQ 273

Query: 420 REEIKRPEASATVKKLFVAGLKQDIEEEDL 509
                   AS   +KL+V  L  +I E+ L
Sbjct: 274 SNASSSGAASGGARKLYVGNLHSNITEDQL 303



 Score = 32.7 bits (71), Expect = 0.33
 Identities = 12/37 (32%), Positives = 23/37 (62%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           R + E+FS  G +  V ++ D+ + + +G G++EF D
Sbjct: 204 RDVYEFFSRAGKVRDVRLIMDRNSRRSKGVGYIEFYD 240


>02_04_0289 +
           21615745-21616155,21617417-21617870,21618162-21618217,
           21618307-21618437,21618565-21618727
          Length = 404

 Score = 33.1 bits (72), Expect = 0.25
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L   F   G +V++ V+ ++ +G   G+GFVEF
Sbjct: 128 LHNCFGPSGEVVTIKVIRNRHSGVSEGYGFVEF 160



 Score = 31.5 bits (68), Expect = 0.76
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +2

Query: 527 FGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           + ++    V+ D  TG+ RG+GFV F D
Sbjct: 229 YRSVKGAKVIIDANTGRSRGYGFVRFGD 256


>08_02_1176 +
           24931728-24931877,24933175-24933275,24934410-24934788,
           24935509-24936354,24936555-24936642,24936947-24937039,
           24937221-24937318,24937364-24937470,24938266-24938353,
           24938748-24939005
          Length = 735

 Score = 32.7 bits (71), Expect = 0.33
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           L  +F+ FG ++ V +VT+  TG+  G  +VEF   +  +R
Sbjct: 595 LSRHFNKFGAVLKVVIVTNAATGQPTGSAYVEFLHKESAER 635


>04_04_1121 -
           31041629-31041793,31041891-31042022,31042255-31042425,
           31042521-31042622,31042703-31042807,31043115-31043286,
           31043916-31043980,31044179-31044502,31044729-31044846,
           31044928-31045011,31045472-31045603,31045714-31046570,
           31046735-31046849,31047371-31047481,31047763-31047824
          Length = 904

 Score = 32.7 bits (71), Expect = 0.33
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 5/48 (10%)
 Frame = +2

Query: 506 LREYFST---FGNIVSVSVVTDKETGKK--RGFGFVEFDDYDPVDRVC 634
           L+++FST    G++ S +V    + GK    GFGFVEFD  +    VC
Sbjct: 698 LKQHFSTKLKSGSLKSATVKKHIKNGKNVSMGFGFVEFDSVETATSVC 745



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 21/79 (26%), Positives = 35/79 (44%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G++    ++ D  TK S G G++ +S       A         GR++  K A P    K
Sbjct: 393 YGDVDQARIVVDKTTKLSTGRGYVLFSLPDSAVRALELDNSSFQGRLLRVKAAKPLNN-K 451

Query: 435 RPEASATVKKLFVAGLKQD 491
           + E+S   KK+ +   K D
Sbjct: 452 KIESSYEEKKMSLKQQKLD 470



 Score = 30.3 bits (65), Expect = 1.8
 Identities = 16/33 (48%), Positives = 20/33 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           LR+ FS FG I S+ +    + G  RGF FVEF
Sbjct: 797 LRQLFSPFGQIKSLRL--PMKFGSHRGFAFVEF 827


>01_06_0006 -
           25517892-25517935,25518156-25518276,25518598-25518733,
           25519189-25519280,25519358-25519426,25519710-25519821,
           25519897-25520015,25520302-25520355,25520811-25520891,
           25520968-25521051,25521124-25521315,25521633-25521746,
           25521832-25521978,25522066-25522302,25522762-25522810,
           25522894-25523027,25523124-25523324,25523532-25523701,
           25523773-25523875,25524198-25524361,25525015-25525055,
           25525144-25525187
          Length = 835

 Score = 32.7 bits (71), Expect = 0.33
 Identities = 21/85 (24%), Positives = 45/85 (52%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+IVD+++++   T ++     ITY+ A + D+    R H I G+ V   R +  + I+
Sbjct: 38  YGKIVDLIIIRAKGTAQAGDSAKITYADAAISDKIIKCR-HIIKGKHVVVDRTLMEDTIQ 96

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +   T +++ + GL   +  +D+
Sbjct: 97  YKD-KKTNRRITLDGLPWTVSNDDI 120


>09_04_0716 +
           19702100-19702250,19702366-19702463,19702527-19702611,
           19702950-19703020,19703119-19703209,19703292-19703367,
           19704047-19704584
          Length = 369

 Score = 32.3 bits (70), Expect = 0.44
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = +2

Query: 521 STFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           S +G + S+ +V D  TG  RG+ FVE++    + R     +H I
Sbjct: 97  SRYGRVKSMRLVRDIVTGASRGYAFVEYETDREMRRAYEDAHHSI 141


>02_02_0008 +
           6061508-6061624,6062468-6062566,6062636-6063039,
           6064218-6064278,6064413-6064466,6064786-6064854,
           6064993-6065058,6065162-6065230,6065448-6065537
          Length = 342

 Score = 32.3 bits (70), Expect = 0.44
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           LR+ F  FG IVSV V+ D+   + + +GFV F   D
Sbjct: 25  LRDAFGRFGTIVSVKVINDQRV-RGKCYGFVTFTHAD 60


>11_06_0326 - 22382001-22383248
          Length = 415

 Score = 31.9 bits (69), Expect = 0.58
 Identities = 14/29 (48%), Positives = 17/29 (58%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           FS FG +    VV  + TG  +GFGFV F
Sbjct: 108 FSRFGPLAECDVVARRATGACKGFGFVTF 136


>10_01_0076 -
           987092-987671,987747-987812,988201-988363,988467-988548,
           989153-989202,989237-989270,990177-990239,990339-990403,
           990485-990560,991274-991353,991514-991628,991729-991830
          Length = 491

 Score = 31.9 bits (69), Expect = 0.58
 Identities = 12/20 (60%), Positives = 16/20 (80%)
 Frame = +2

Query: 545 VSVVTDKETGKKRGFGFVEF 604
           V +VTDKET K RG+ F+E+
Sbjct: 196 VRLVTDKETNKPRGYAFIEY 215


>02_04_0518 + 23601355-23602498,23603481-23603779
          Length = 480

 Score = 31.9 bits (69), Expect = 0.58
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           F+ FG +     V D+ TG+ RG+GFV F
Sbjct: 124 FAPFGALDECHAVADRATGRCRGYGFVTF 152


>11_08_0081 -
           28216179-28216381,28216590-28216657,28217131-28217298,
           28217370-28217436,28217509-28217576,28218256-28218420,
           28218490-28218556,28218629-28218696,28219855-28219992,
           28220189-28220353,28221227-28221304,28221380-28221532,
           28222753-28222823,28223077-28223203,28223306-28223565,
           28223679-28223842,28224287-28224450,28225873-28226159
          Length = 826

 Score = 31.5 bits (68), Expect = 0.76
 Identities = 14/29 (48%), Positives = 17/29 (58%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           F  FG +  V +  D  TG+ RGF FVEF
Sbjct: 417 FQKFGPVRDVYLPKDYNTGEPRGFAFVEF 445


>03_01_0160 + 1302366-1302731,1303318-1303364,1303455-1303800
          Length = 252

 Score = 31.5 bits (68), Expect = 0.76
 Identities = 14/41 (34%), Positives = 25/41 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           LR++F +   I S+    +K TG  RGF  V+F+D + +++
Sbjct: 189 LRDFFKSL-KISSIRFAINKRTGDSRGFCHVDFEDDESLEK 228



 Score = 29.9 bits (64), Expect = 2.3
 Identities = 17/54 (31%), Positives = 25/54 (46%)
 Frame = +2

Query: 461 KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           KVV S          +RE F  FG + S+ +    ++G  RG  FV F+  + V
Sbjct: 74  KVVASGLPYTTTEAEIRELFERFGPLRSLQLSRFPDSGNFRGLAFVSFESNEVV 127


>01_06_1775 - 39808794-39808919,39809021-39809127,39810594-39812178
          Length = 605

 Score = 31.5 bits (68), Expect = 0.76
 Identities = 12/27 (44%), Positives = 18/27 (66%)
 Frame = +2

Query: 530 GNIVSVSVVTDKETGKKRGFGFVEFDD 610
           G  + V ++ DK +G+ RGFGFV F +
Sbjct: 524 GGHLHVRIMYDKNSGRSRGFGFVHFSN 550


>02_04_0661 -
           24802868-24802921,24803004-24803089,24803178-24803274,
           24803378-24803475,24804705-24804882,24805485-24805676
          Length = 234

 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L + FS + +     V+ DK TGK RG+ FV F
Sbjct: 142 LTKAFSKYPSFNMARVIRDKWTGKTRGYAFVSF 174


>12_02_1265 - 27435096-27437675
          Length = 859

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 12/27 (44%), Positives = 21/27 (77%)
 Frame = -1

Query: 673 PNVESFNLVILLQAYSVNWIIIIKLYK 593
           PN+ ++N++I LQA + N+  ++KLYK
Sbjct: 504 PNLVTYNIMIALQAKARNYENVVKLYK 530


>07_01_0413 -
           3155080-3155274,3155628-3155933,3156062-3156163,
           3156262-3156705
          Length = 348

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           LR  F     ++   V+ ++++G+ RGFGFV F
Sbjct: 236 LRAAFEGQPGLLDARVIFERDSGRSRGFGFVSF 268


>05_04_0383 -
           20801036-20801309,20801413-20801538,20801706-20801730,
           20801808-20802259,20802330-20802394,20802487-20802711,
           20804750-20804878,20805095-20805306,20806861-20806894
          Length = 513

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 12/34 (35%), Positives = 19/34 (55%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           G +VD+ + +D +T RSKG+ F  Y    +   A
Sbjct: 31  GRVVDLHIPRDKETNRSKGYAFAEYETEEIAQYA 64


>05_01_0112 -
           757514-758444,758525-758571,759074-759236,759861-760366
          Length = 548

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 22/95 (23%), Positives = 41/95 (43%), Gaps = 2/95 (2%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRI--VEPK 407
           I+    A G I  V  M  P++ + +G   +T+        A       + G    ++P 
Sbjct: 190 IRSFFEACGSITSVDCMTFPESGKFRGIAILTFKTDAAAQRALALDGADMGGFFLKIQPY 249

Query: 408 RAVPREEIKRPEASATVKKLFVAGLKQDIEEEDLE 512
           ++V  +E   P+      +++V  L  DI E+DL+
Sbjct: 250 KSVREKEDFAPKMIEGYNRVYVGNLAWDITEDDLK 284



 Score = 28.3 bits (60), Expect = 7.1
 Identities = 7/28 (25%), Positives = 20/28 (71%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           E  ++ +K+++GG+ Y +++  ++ F+E
Sbjct: 168 ESEKNAKKVYVGGIPYYSSEDDIRSFFE 195



 Score = 27.9 bits (59), Expect = 9.4
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L+++FS    I S+   TDKETG  +G+  V+F +
Sbjct: 283 LKKFFSDC-KISSIRFGTDKETGDFKGYVHVDFSE 316


>03_06_0507 +
           34404843-34404968,34405091-34405151,34405260-34405296,
           34405365-34405386,34405861-34405957,34406037-34406180,
           34407034-34407173,34408205-34408255,34408347-34408429,
           34408515-34408590,34408646-34408760,34409080-34409575,
           34409682-34409895,34410000-34410070,34410527-34410695,
           34410787-34410916,34411330-34411742,34411839-34412039
          Length = 881

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 15/38 (39%), Positives = 20/38 (52%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           E FS FG + S   V  K T + RG GF++F   +  D
Sbjct: 463 ERFSAFGKVESFFPVLHKLTKRPRGTGFLKFSTAEAAD 500


>01_01_0201 +
           1746088-1747086,1748735-1748806,1750106-1750168,
           1750355-1750489,1750604-1750669
          Length = 444

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 3/68 (4%)
 Frame = +3

Query: 276 VVMKDPKTKRSKGFGF---ITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPEA 446
           V+ K PKTKR  GFG      +S+ H+   A + +P +    + E   A   +     +A
Sbjct: 14  VMAKKPKTKRLSGFGLKPSAAFSRPHVPSAAASLQPSRRVRVVFEDPDATDSDSDDDEDA 73

Query: 447 SATVKKLF 470
            A  KK +
Sbjct: 74  GAASKKRY 81


>06_03_1263 + 28828048-28828347
          Length = 99

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETG-KKRGFGFVEFDDYDPVDRVC 634
           LR+     G + S+ +  D++ G ++RGF FVE+ D +     C
Sbjct: 26  LRDACEEIGPVESLRLAVDEDAGNRRRGFAFVEYLDDETARSAC 69


>03_06_0337 +
           33224333-33224479,33224603-33224663,33224740-33224776,
           33225237-33225367,33225447-33225590,33225686-33225776,
           33225973-33226106,33226234-33226373,33227328-33227426,
           33227520-33227602,33227690-33227744,33227826-33227937,
           33228274-33228766,33228881-33229094,33229203-33229273,
           33229733-33229901,33229991-33230120,33230556-33230968,
           33231059-33231262
          Length = 975

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 15/38 (39%), Positives = 20/38 (52%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           E FS FG + S   V  K T + RG GF++F   +  D
Sbjct: 556 ERFSAFGKVESFFPVLHKLTKRPRGTGFLKFSTPEAAD 593



 Score = 28.3 bits (60), Expect = 7.1
 Identities = 15/47 (31%), Positives = 22/47 (46%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L   FS  G +    +V  K +   RGFGFV+F      +R   Q++
Sbjct: 50  LEAVFSEVGPVRRCFMVAPKGSETSRGFGFVQFATVQDAERSIQQKD 96


>03_03_0042 +
           14009649-14009866,14011342-14011419,14011791-14011955,
           14012071-14012138,14012219-14012258,14013579-14013690,
           14013859-14013942
          Length = 254

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 2/52 (3%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQ--NHQI 655
           +R  F  FG +  V +  +  T + RGFGFV+F  Y P D    +Q  NHQ+
Sbjct: 77  IRIPFEQFGPVKDVYLPRNFHTRELRGFGFVKF-RY-PEDAAVAKQELNHQV 126


>07_01_0577 -
           4286048-4286186,4286600-4286660,4286957-4287089,
           4287286-4287350,4288346-4288451,4288529-4288750,
           4289619-4289852,4289948-4290037,4290605-4291507
          Length = 650

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 12/34 (35%), Positives = 19/34 (55%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +L+E F   G I SV +  D  + K+R F F+ +
Sbjct: 426 QLKEIFKKHGKIESVVLSRDMPSAKRRDFAFINY 459


>03_05_0066 -
           20455976-20456161,20456251-20456347,20456608-20456738,
           20456814-20456869,20457498-20457543
          Length = 171

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%)
 Frame = +1

Query: 157 GDDYEEPEHTRKLFIGGLDYRTTDSSLKE-FYEHGE 261
           G D +   +   +F+GGLD   TD  LK+ F  +GE
Sbjct: 23  GTDSDSDPNNTTVFVGGLDPSVTDEVLKQAFSPYGE 58


>12_02_0871 +
           23865343-23866016,23866122-23866170,23866276-23866356,
           23866599-23866718,23866957-23867055,23867135-23867194,
           23867316-23867410,23867483-23867508,23869212-23869285,
           23870194-23870259,23871027-23871099,23871585-23871622,
           23873758-23873871,23876079-23876195,23876288-23876368,
           23876468-23876536,23876631-23876669,23876809-23876973,
           23877380-23877484,23877569-23877637,23877754-23877816,
           23877903-23878021,23878124-23878348,23878409-23878610
          Length = 940

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 12/41 (29%), Positives = 20/41 (48%)
 Frame = +1

Query: 133 LNMKPSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYEH 255
           +N    ES  D +E    +  F+G L    T+  L++ +EH
Sbjct: 546 INWAEKESHVDEDEMAKVKTAFVGNLPANVTEEYLRKLFEH 586


>02_01_0500 -
           3623837-3624019,3624591-3624778,3625209-3626147,
           3626311-3626479,3626701-3626871,3626948-3627016,
           3627094-3627201,3627844-3627997,3628659-3628738,
           3628822-3628914,3628951-3629073,3629165-3629915,
           3630123-3630163,3630338-3630385
          Length = 1038

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 3/51 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFI---TYSQAHMVDEAQNNRPHKIDGRIV 398
           WG +  V V+K+  +  S+GF FI   T   A  + E   +    IDGR V
Sbjct: 324 WGPLRSVRVIKERSSGMSRGFAFIDFPTVEAARRMMEGVGDNGLLIDGRKV 374


>07_03_1339 +
           25879246-25881154,25881502-25881696,25881777-25881928,
           25882147-25882607,25883723-25883810,25884066-25884135,
           25884288-25884361,25884456-25884524,25884647-25884724,
           25884946-25885070,25885168-25885240,25885508-25885566,
           25885650-25886027,25886134-25886236,25886332-25886544
          Length = 1348

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 11/33 (33%), Positives = 20/33 (60%)
 Frame = +1

Query: 145 PSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKE 243
           PS  GDD + P+  +++ +  +  + TD SLK+
Sbjct: 450 PSSVGDDLQTPDDDKEISLIDMSLQDTDMSLKK 482


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,118,914
Number of Sequences: 37544
Number of extensions: 339849
Number of successful extensions: 1245
Number of sequences better than 10.0: 129
Number of HSP's better than 10.0 without gapping: 957
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1237
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 2051430072
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).