SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30010
         (545 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_01_0963 - 7577207-7577992,7578506-7578622,7578711-7578921,757...    29   3.2  
09_01_0168 + 2448444-2448818,2448919-2449408,2450664-2450857           27   9.8  
01_06_1236 + 35613123-35613816,35615809-35615952,35616032-356161...    27   9.8  

>01_01_0963 -
           7577207-7577992,7578506-7578622,7578711-7578921,
           7579406-7579442,7580781-7580902,7581292-7581500
          Length = 493

 Score = 28.7 bits (61), Expect = 3.2
 Identities = 15/41 (36%), Positives = 20/41 (48%)
 Frame = +3

Query: 186 HYIKLTHPMCVTSTYYLLSA*NRFLFTKMDFACSKATITCS 308
           HY   +HP  +T+ YY     N +L     FA  KA + CS
Sbjct: 326 HYYTCSHPSELTAGYYNTLLRNGYLPITQMFARYKAALCCS 366


>09_01_0168 + 2448444-2448818,2448919-2449408,2450664-2450857
          Length = 352

 Score = 27.1 bits (57), Expect = 9.8
 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 9/40 (22%)
 Frame = +2

Query: 407 SGLSGAGSWPVRRIGSRD---------NAVGNTGNGKIKG 499
           +GL+  G  P  RIG+RD         NAV  + NGK++G
Sbjct: 216 TGLTPMGCLPAERIGNRDNPGECNEDYNAVARSFNGKLQG 255


>01_06_1236 +
           35613123-35613816,35615809-35615952,35616032-35616184,
           35616572-35616687,35616800-35616967,35617647-35617707,
           35617772-35617824,35618278-35618508,35618600-35618749
          Length = 589

 Score = 27.1 bits (57), Expect = 9.8
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%)
 Frame = -1

Query: 452 ILYDE-LASYRRRTDPKRPDLHYSISNFNYSAIELLK 345
           I YDE +A  +  TD ++   HYS   FN  +++L+K
Sbjct: 544 ISYDEFVAMMKTGTDWRKASRHYSRGRFNSLSMKLIK 580


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,213,780
Number of Sequences: 37544
Number of extensions: 249973
Number of successful extensions: 482
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 476
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 481
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1222086348
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).