SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30009
         (801 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_01_0435 + 5693035-5693669,5694999-5695241,5695806-5696007,569...    28   9.9  

>04_01_0435 +
           5693035-5693669,5694999-5695241,5695806-5696007,
           5696188-5696583
          Length = 491

 Score = 27.9 bits (59), Expect = 9.9
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 3/51 (5%)
 Frame = +2

Query: 521 ITKIRLRLNHFDSDIALYSSITTLK-IVGFALIHP--VLRNVFEYKLVFQE 664
           I + +L LN + SD+ LYS + +L  ++ F   HP  V +N+  Y  + QE
Sbjct: 325 IAEFKLSLNAYLSDL-LYSPVRSLADVIAFNKAHPVEVRKNLVLYDALLQE 374


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,313,758
Number of Sequences: 37544
Number of extensions: 344470
Number of successful extensions: 556
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 540
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 556
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2174172540
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).