SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30008
         (465 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

09_02_0577 - 10862976-10863215,10863653-10863788,10863906-108640...    60   1e-09
09_02_0576 - 10853361-10853600,10854033-10854168,10854285-108544...    60   1e-09
03_02_0140 + 5864612-5864955,5865154-5865381,5865460-5865814,586...    60   1e-09
09_04_0707 + 19645471-19646112                                         51   5e-07
12_02_1195 + 26906814-26907121,26907771-26907992,26908913-269091...    33   0.11 
12_02_1185 + 26786543-26786545,26786676-26786686,26787032-267872...    33   0.11 
12_02_1087 - 25949878-25950369,25950386-25950944,25950988-25951388     30   0.80 
09_04_0704 + 19623046-19623386,19623583-19623792,19623872-196242...    30   0.80 
03_02_0920 + 12410551-12410893,12410992-12411095,12411192-124112...    30   0.80 
04_04_0714 + 27496678-27497392,27499080-27499138,27499179-27499370     29   1.8  
02_01_0163 + 1135592-1135623,1135718-1135816,1135904-1135960,113...    29   2.4  
04_04_1029 + 30243218-30244163,30246090-30246254,30246775-30247985     28   3.2  
02_05_1260 + 35299795-35299905,35300065-35300112,35301181-35302356     28   3.2  
08_01_0290 - 2335365-2335901                                           28   4.3  
04_04_1046 + 30405805-30405858,30405991-30407950,30408460-30408476     28   4.3  
04_03_1017 + 21747044-21748051                                         27   5.6  
02_05_0289 + 27567549-27567830,27568166-27568284,27569295-27569724     27   5.6  
01_05_0278 - 20313373-20313387,20314617-20315240                       27   5.6  
08_02_1130 + 24517319-24518149,24519374-24519868,24519954-245201...    27   7.4  
08_01_1010 - 10215625-10216335,10216372-10216473                       27   7.4  
06_03_1114 + 27719099-27719252,27719340-27719570,27720508-277211...    27   7.4  
03_06_0065 - 31399791-31399874,31399956-31400165,31400407-314005...    27   7.4  
03_01_0116 + 922881-923192,923660-923778,923949-924378                 27   7.4  
02_05_0593 - 30217432-30218232                                         27   7.4  
02_03_0357 + 18075171-18077240                                         27   7.4  
11_05_0085 - 18963617-18964294                                         27   9.8  
02_05_0727 + 31264798-31265297,31265962-31266417,31266503-31266938     27   9.8  

>09_02_0577 -
           10862976-10863215,10863653-10863788,10863906-10864030,
           10864132-10864516,10864571-10864798,10864976-10865319
          Length = 485

 Score = 59.7 bits (138), Expect = 1e-09
 Identities = 26/29 (89%), Positives = 29/29 (100%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIPTAAAFGG+CIGAL+VLADF+GAIGSG
Sbjct: 427 YIPTAAAFGGVCIGALTVLADFMGAIGSG 455



 Score = 45.2 bits (102), Expect = 3e-05
 Identities = 23/32 (71%), Positives = 25/32 (78%), Gaps = 1/32 (3%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQA-EMG 165
           G    GTGILLAVTIIYQYFE F KE+A E+G
Sbjct: 450 GAIGSGTGILLAVTIIYQYFETFEKERATELG 481


>09_02_0576 -
           10853361-10853600,10854033-10854168,10854285-10854409,
           10854487-10854871,10854934-10855161,10855332-10855675
          Length = 485

 Score = 59.7 bits (138), Expect = 1e-09
 Identities = 26/29 (89%), Positives = 29/29 (100%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIPTAAAFGG+CIGAL+VLADF+GAIGSG
Sbjct: 427 YIPTAAAFGGVCIGALTVLADFMGAIGSG 455



 Score = 45.2 bits (102), Expect = 3e-05
 Identities = 23/32 (71%), Positives = 25/32 (78%), Gaps = 1/32 (3%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQA-EMG 165
           G    GTGILLAVTIIYQYFE F KE+A E+G
Sbjct: 450 GAIGSGTGILLAVTIIYQYFETFEKERATELG 481


>03_02_0140 +
           5864612-5864955,5865154-5865381,5865460-5865814,
           5865899-5866023,5866150-5866285,5866382-5866621
          Length = 475

 Score = 59.7 bits (138), Expect = 1e-09
 Identities = 26/29 (89%), Positives = 29/29 (100%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIPTAAAFGG+CIGAL+VLADF+GAIGSG
Sbjct: 417 YIPTAAAFGGVCIGALTVLADFMGAIGSG 445



 Score = 45.2 bits (102), Expect = 3e-05
 Identities = 23/32 (71%), Positives = 25/32 (78%), Gaps = 1/32 (3%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQA-EMG 165
           G    GTGILLAVTIIYQYFE F KE+A E+G
Sbjct: 440 GAIGSGTGILLAVTIIYQYFETFEKERATELG 471


>09_04_0707 + 19645471-19646112
          Length = 213

 Score = 50.8 bits (116), Expect = 5e-07
 Identities = 22/29 (75%), Positives = 25/29 (86%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YI TAAA GGLC+GAL++LAD  GAIGSG
Sbjct: 164 YISTAAALGGLCVGALTILADMTGAIGSG 192



 Score = 32.3 bits (70), Expect = 0.20
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +1

Query: 70  SGPSAPGTGILLAVTIIYQYFEIFVKEQ 153
           +G    GTGILLA T++Y   + F KE+
Sbjct: 186 TGAIGSGTGILLAATVVYNLIDAFQKEE 213


>12_02_1195 +
           26906814-26907121,26907771-26907992,26908913-26909153,
           26909512-26909642,26910336-26910474,26910600-26910810,
           26911371-26911759
          Length = 546

 Score = 33.1 bits (72), Expect = 0.11
 Identities = 15/27 (55%), Positives = 18/27 (66%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIG 83
           Y+  AA F G C+G LS+LA FLG  G
Sbjct: 376 YMTIAAIFVGFCVGFLSLLAGFLGLDG 402


>12_02_1185 +
           26786543-26786545,26786676-26786686,26787032-26787262,
           26787892-26788012,26788263-26788393,26788718-26788760,
           26788963-26789220
          Length = 265

 Score = 33.1 bits (72), Expect = 0.11
 Identities = 14/29 (48%), Positives = 20/29 (68%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           Y+  AA   G+C+G L++LA F+G  GSG
Sbjct: 210 YMTMAAYIVGICVGLLNLLAGFMGLGGSG 238


>12_02_1087 - 25949878-25950369,25950386-25950944,25950988-25951388
          Length = 483

 Score = 30.3 bits (65), Expect = 0.80
 Identities = 14/26 (53%), Positives = 17/26 (65%)
 Frame = +3

Query: 6   IPTAAAFGGLCIGALSVLADFLGAIG 83
           I  AAA GG  +G L+V A  +GAIG
Sbjct: 427 IAAAAAVGGFAVGGLAVYAGAVGAIG 452


>09_04_0704 +
           19623046-19623386,19623583-19623792,19623872-19624223,
           19624320-19624444,19624578-19624668,19624817-19625050
          Length = 450

 Score = 30.3 bits (65), Expect = 0.80
 Identities = 12/29 (41%), Positives = 16/29 (55%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           ++  AA  GG C G L + AD +G   SG
Sbjct: 396 HVMRAACVGGFCAGVLIIFADLIGVFCSG 424



 Score = 27.1 bits (57), Expect = 7.4
 Identities = 18/56 (32%), Positives = 21/56 (37%), Gaps = 4/56 (7%)
 Frame = +1

Query: 10  RRRPRSEDCASGLCQ----CWPTSSGPSAPGTGILLAVTIIYQYFEIFVKEQAEMG 165
           RR      C  G C      +    G    GTGI+LAVT  Y Y +    E    G
Sbjct: 394 RRHVMRAACVGGFCAGVLIIFADLIGVFCSGTGIMLAVTASYPYVDGRASEVGSFG 449


>03_02_0920 +
           12410551-12410893,12410992-12411095,12411192-12411297,
           12411388-12411607,12411733-12411917,12411988-12412103,
           12412208-12412279,12412551-12412598
          Length = 397

 Score = 30.3 bits (65), Expect = 0.80
 Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 3/85 (3%)
 Frame = -1

Query: 312 DVFTSNTTRYENVHLMMSIRAETTIKTELNAAVRLPLSLRDLEEQCAHAAHLRLFLDKDL 133
           +VF SN   Y +    ++++  TTI  E+ A V+    + +          L + +D D 
Sbjct: 254 EVFESNLDEYLDARKGVNLQKSTTIFAEIMAGVK---EIHEAGIIHRDLKPLNILIDSDD 310

Query: 132 EVLVND---GDGEQYPSARSRWPRG 67
            + + D      + YPSA  R+P G
Sbjct: 311 HIYITDFGISKIKPYPSANVRYPGG 335


>04_04_0714 + 27496678-27497392,27499080-27499138,27499179-27499370
          Length = 321

 Score = 29.1 bits (62), Expect = 1.8
 Identities = 17/38 (44%), Positives = 21/38 (55%)
 Frame = +3

Query: 18  AAFGGLCIGALSVLADFLGAIGSGHWDTARRHHHLPVL 131
           AA G   +GA   LAD   + G+GHW    RHHH  +L
Sbjct: 265 AAHGSSRVGA-ERLADSPES-GNGHWIHPSRHHHRQIL 300


>02_01_0163 +
           1135592-1135623,1135718-1135816,1135904-1135960,
           1136053-1136116,1136174-1136392,1138562-1138945
          Length = 284

 Score = 28.7 bits (61), Expect = 2.4
 Identities = 12/26 (46%), Positives = 15/26 (57%)
 Frame = -3

Query: 88  PEPMAPRKSASTDRAPMHSPPNAAAV 11
           P+P  PR  A  D+AP+   P  AAV
Sbjct: 190 PQPPPPRNQAQADKAPIPVAPPGAAV 215


>04_04_1029 + 30243218-30244163,30246090-30246254,30246775-30247985
          Length = 773

 Score = 28.3 bits (60), Expect = 3.2
 Identities = 18/65 (27%), Positives = 28/65 (43%)
 Frame = -1

Query: 255 RAETTIKTELNAAVRLPLSLRDLEEQCAHAAHLRLFLDKDLEVLVNDGDGEQYPSARSRW 76
           +A  T + +++ A    L+L+      A       FLDKD +V  + GDG       +  
Sbjct: 195 KACCTTEMQMDGAQEFNLTLKPSGNVEASTCSAVFFLDKDEQVFTSAGDGRNMALKEALV 254

Query: 75  PRGSR 61
           P G R
Sbjct: 255 PLGYR 259


>02_05_1260 + 35299795-35299905,35300065-35300112,35301181-35302356
          Length = 444

 Score = 28.3 bits (60), Expect = 3.2
 Identities = 10/21 (47%), Positives = 12/21 (57%)
 Frame = -3

Query: 88  PEPMAPRKSASTDRAPMHSPP 26
           PEP+ PR  A     P+H PP
Sbjct: 83  PEPLPPRTDAPMPEIPIHPPP 103


>08_01_0290 - 2335365-2335901
          Length = 178

 Score = 27.9 bits (59), Expect = 4.3
 Identities = 11/37 (29%), Positives = 17/37 (45%)
 Frame = +1

Query: 58  WPTSSGPSAPGTGILLAVTIIYQYFEIFVKEQAEMGG 168
           WP ++ PSAPG     A   +++Y +         GG
Sbjct: 98  WPLATDPSAPGAARAAAQACVHKYRDARAAADGRRGG 134


>04_04_1046 + 30405805-30405858,30405991-30407950,30408460-30408476
          Length = 676

 Score = 27.9 bits (59), Expect = 4.3
 Identities = 18/72 (25%), Positives = 31/72 (43%)
 Frame = -3

Query: 439 ISYKLAHHPRTRRHAHNTTPVGALPSTQQILNLKSNFFDKVQRCIHIQHYQI*KRTPNDV 260
           +S  L   P  RRH       GA  +T+  L+  ++    ++  I     +  +R+P   
Sbjct: 216 LSVNLVPPPLARRHGSQRGGRGAATTTK--LSSSTDVAATIRSSIRPSSREFMERSPRRA 273

Query: 259 DSSRNDNKNGAE 224
             + ND K GA+
Sbjct: 274 GEAENDRKEGAD 285


>04_03_1017 + 21747044-21748051
          Length = 335

 Score = 27.5 bits (58), Expect = 5.6
 Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 1/33 (3%)
 Frame = -3

Query: 109 RRAVSQCPEPMAP-RKSASTDRAPMHSPPNAAA 14
           RRA S    P  P R++AS D  PM SPP  AA
Sbjct: 214 RRAASPDYSPSTPPRRAASPDYTPM-SPPRRAA 245


>02_05_0289 + 27567549-27567830,27568166-27568284,27569295-27569724
          Length = 276

 Score = 27.5 bits (58), Expect = 5.6
 Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 1/27 (3%)
 Frame = +1

Query: 355 VELKAALLPA*CC-VRGGACVDDVLIY 432
           ++LK ++L   C   +GG CVD VLIY
Sbjct: 236 MKLKFSMLQIDCTHTKGGLCVDSVLIY 262


>01_05_0278 - 20313373-20313387,20314617-20315240
          Length = 212

 Score = 27.5 bits (58), Expect = 5.6
 Identities = 12/30 (40%), Positives = 17/30 (56%)
 Frame = -3

Query: 97 SQCPEPMAPRKSASTDRAPMHSPPNAAAVG 8
          S  P P +P +S +   + MH PP+ AA G
Sbjct: 7  SPFPPPPSPAESNAPSASAMHHPPHPAAGG 36


>08_02_1130 +
          24517319-24518149,24519374-24519868,24519954-24520179,
          24520267-24520291,24520925-24521234,24521328-24521888
          Length = 815

 Score = 27.1 bits (57), Expect = 7.4
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = -3

Query: 94 QCPEPMAPRKSASTDRAPMHSP 29
          Q PEP A  +++ST  +P H P
Sbjct: 11 QRPEPQAKEENSSTSASPSHDP 32


>08_01_1010 - 10215625-10216335,10216372-10216473
          Length = 270

 Score = 27.1 bits (57), Expect = 7.4
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = -3

Query: 82  PMAPRKSASTDRAPMHSPPNAAA 14
           P  PR++AS D  P   PP AA+
Sbjct: 108 PTPPRRAASPDYTPSTPPPRAAS 130



 Score = 27.1 bits (57), Expect = 7.4
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = -3

Query: 82  PMAPRKSASTDRAPMHSPPNAAA 14
           P  PR++AS D  P   PP AA+
Sbjct: 168 PTPPRRAASLDYTPSTPPPRAAS 190


>06_03_1114 +
           27719099-27719252,27719340-27719570,27720508-27721148,
           27721225-27722124
          Length = 641

 Score = 27.1 bits (57), Expect = 7.4
 Identities = 12/38 (31%), Positives = 21/38 (55%)
 Frame = -1

Query: 132 EVLVNDGDGEQYPSARSRWPRGSRPALTEPRCTVLRTR 19
           ++ ++DG+  +   ARSRW +      TE   +V+R R
Sbjct: 519 DLFLDDGESPEMVGARSRWSQIKFSGATESGGSVVRVR 556


>03_06_0065 -
           31399791-31399874,31399956-31400165,31400407-31400526,
           31401166-31401225,31401670-31401879,31402512-31402587,
           31403010-31403173,31403254-31403316,31403640-31403727,
           31403810-31404460,31405102-31405149,31405334-31405902
          Length = 780

 Score = 27.1 bits (57), Expect = 7.4
 Identities = 12/37 (32%), Positives = 19/37 (51%)
 Frame = -3

Query: 115 W*RRAVSQCPEPMAPRKSASTDRAPMHSPPNAAAVGM 5
           W +R+VS  P P +   SAST  +P  +  +    G+
Sbjct: 3   WWKRSVSPSPSPSSSSASASTPASPARASTSRVGGGV 39


>03_01_0116 + 922881-923192,923660-923778,923949-924378
          Length = 286

 Score = 27.1 bits (57), Expect = 7.4
 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%)
 Frame = +1

Query: 355 VELKAALLPA*CC-VRGGACVDDVLIY 432
           ++LK +L    C   +GG CVD VLIY
Sbjct: 246 IKLKFSLAQIDCTHTKGGLCVDSVLIY 272


>02_05_0593 - 30217432-30218232
          Length = 266

 Score = 27.1 bits (57), Expect = 7.4
 Identities = 11/28 (39%), Positives = 14/28 (50%)
 Frame = -3

Query: 97  SQCPEPMAPRKSASTDRAPMHSPPNAAA 14
           ++ P      K  STD +  H PPNA A
Sbjct: 177 AEAPSSATESKPNSTDASSKHGPPNAGA 204


>02_03_0357 + 18075171-18077240
          Length = 689

 Score = 27.1 bits (57), Expect = 7.4
 Identities = 9/15 (60%), Positives = 13/15 (86%)
 Frame = +3

Query: 120 LPVLRDLCQGTSGDG 164
           +P ++DLC G+SGDG
Sbjct: 379 IPEMKDLCLGSSGDG 393


>11_05_0085 - 18963617-18964294
          Length = 225

 Score = 26.6 bits (56), Expect = 9.8
 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 2/41 (4%)
 Frame = -3

Query: 262 VDSSRNDNKNGAE--RSGPTAAIITRLRRAVCSCRPSPLVP 146
           +D+   D ++G     +GP   ++T L R V + RP P +P
Sbjct: 97  LDAVVRDTEDGVPVPATGPRITLLTELARDVSTQRPPPFLP 137


>02_05_0727 + 31264798-31265297,31265962-31266417,31266503-31266938
          Length = 463

 Score = 26.6 bits (56), Expect = 9.8
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +2

Query: 14  GGRVRRTVHRGSVSAGRLPRGHRLR 88
           G R+ R V R + S+ +LP G RLR
Sbjct: 28  GRRMARLVTRAAASSPKLPSGRRLR 52


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,399,207
Number of Sequences: 37544
Number of extensions: 283710
Number of successful extensions: 1157
Number of sequences better than 10.0: 27
Number of HSP's better than 10.0 without gapping: 1083
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1153
length of database: 14,793,348
effective HSP length: 76
effective length of database: 11,940,004
effective search space used: 931320312
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).