SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30007
         (796 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_02_0602 + 19183549-19184919                                         32   0.60 
01_06_0666 + 31040768-31041079,31041716-31041889,31041996-31042646     31   1.4  
06_01_0025 - 244068-244177,244279-244333,244500-244527,244621-24...    29   4.3  
05_04_0190 - 18922555-18923349                                         28   9.8  

>08_02_0602 + 19183549-19184919
          Length = 456

 Score = 31.9 bits (69), Expect = 0.60
 Identities = 25/74 (33%), Positives = 35/74 (47%), Gaps = 3/74 (4%)
 Frame = +3

Query: 297 ATNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEE---YAHPKYDFAYSVADG 467
           A+  +AAA P   A  +  A     V +    +L+SA HE     YA+ + D A   ADG
Sbjct: 198 ASGSVAAALP---AGVLDDACADLDVTSSNQPLLLSAEHEVVDALYANQEADAAILHADG 254

Query: 468 HSGDNKSQHESRDG 509
           H   ++SQ E   G
Sbjct: 255 HHNQDESQREHHHG 268


>01_06_0666 + 31040768-31041079,31041716-31041889,31041996-31042646
          Length = 378

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 17/59 (28%), Positives = 32/59 (54%)
 Frame = +3

Query: 261 SSQTILRHDQPHATNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPK 437
           SS+  +RH + H+++ +  A P+  A P+  ++P++    P   +  S HHE +  H K
Sbjct: 209 SSRIAIRHSRDHSSDCLTPA-PMPPA-PLSCSSPISIKQPPRLSIQRSQHHERDTRHAK 265


>06_01_0025 -
           244068-244177,244279-244333,244500-244527,244621-244691,
           244829-244926,245069-245186,245573-245636,245744-245808,
           245893-245928,246255-246311,246422-246691
          Length = 323

 Score = 29.1 bits (62), Expect = 4.3
 Identities = 18/53 (33%), Positives = 22/53 (41%)
 Frame = +3

Query: 309 IAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADG 467
           +AAA P  YA  +  AAP A +  P      S     EY H  Y F   +  G
Sbjct: 43  LAAAHPYGYAPWLANAAPAALLRRPVSTTFYSFDLLREYPHDPYAFTQGLLYG 95


>05_04_0190 - 18922555-18923349
          Length = 264

 Score = 27.9 bits (59), Expect = 9.8
 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 3/51 (5%)
 Frame = -1

Query: 148 WHGAVA--GRDGRCSEKRQP-QLKNIAAPVGDLLHSLPAQRSRLRF*RTWC 5
           W G ++  G  G     + P  +K +    GD+L  +  +  RLR   TWC
Sbjct: 160 WSGTLSRGGGGGGAKRCKHPVAVKRVPVTAGDVLEGVQEEVERLRRAATWC 210


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,786,172
Number of Sequences: 37544
Number of extensions: 229369
Number of successful extensions: 710
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 697
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 709
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2150667972
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).