SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30006
         (796 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_04_0827 - 28457858-28458028,28458513-28458669,28458984-284590...    29   5.6  
06_03_0181 + 17618888-17619125,17621503-17621683,17621765-176219...    28   7.4  

>04_04_0827 - 28457858-28458028,28458513-28458669,28458984-28459083,
            28459204-28459231,28459321-28459396,28461276-28461355,
            28461642-28461805,28461897-28462056,28462154-28462277,
            28462901-28463941,28464141-28464259,28464512-28464823,
            28465222-28465425,28466068-28466751,28467301-28467474
          Length = 1197

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 13/44 (29%), Positives = 20/44 (45%)
 Frame = +3

Query: 489  FVMINYCAFLVKQIRFYLLYSHYSVYFFLFTSFAYSFIFTLKFH 620
            FV IN   FL+  I+F   Y HY+          +  +F + F+
Sbjct: 1044 FVDINKPTFLLPDIKFITFYQHYNSISIAICLIYHGAVFNIHFN 1087


>06_03_0181 +
           17618888-17619125,17621503-17621683,17621765-17621906,
           17622002-17622071,17622162-17622307,17623382-17623948,
           17624558-17624641,17624723-17624797,17625049-17625217,
           17625395-17625586,17625662-17626053
          Length = 751

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 10/28 (35%), Positives = 15/28 (53%)
 Frame = -3

Query: 749 WPLRGFTKYSRFKDKPALGQQYYWNDNT 666
           W LR +T   R+ D   +    +W+DNT
Sbjct: 448 WKLRTYTGLGRWPDGTVVASDKWWDDNT 475


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,240,136
Number of Sequences: 37544
Number of extensions: 320965
Number of successful extensions: 632
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 611
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 629
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2150667972
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).