SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30005
         (981 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_02_1023 + 13265179-13265330,13265526-13265637,13265752-132660...    29   4.3  
01_06_1155 - 34957402-34957824                                         29   5.7  

>03_02_1023 + 13265179-13265330,13265526-13265637,13265752-13266048,
            13266361-13266623,13267637-13267847,13268420-13268590,
            13268671-13268748,13269275-13269520,13269763-13271868,
            13272122-13273904,13274113-13274216,13274752-13275108,
            13275210-13275328,13276175-13276436,13276669-13276893,
            13277075-13277214,13278087-13278159,13278431-13278532,
            13278647-13279018,13279183-13279230,13279516-13279900,
            13280440-13280558
          Length = 2574

 Score = 29.5 bits (63), Expect = 4.3
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = -2

Query: 239  RFPGYGPRNFTNGSSLPIEQVLCER**IFDAEL 141
            RFP +G   F    +LP+++V+ E+   FDA L
Sbjct: 1500 RFPRFGVPRFIRSGNLPLDRVMTEQFIRFDASL 1532


>01_06_1155 - 34957402-34957824
          Length = 140

 Score = 29.1 bits (62), Expect = 5.7
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = -2

Query: 128 RICLPSASRPATTGLSPLAKSMPNSLSCVREV 33
           R+CLPS +RP    L+ +A   PN    +R++
Sbjct: 17  RVCLPSPTRPPPRPLNHVAGKPPNRCRFLRQI 48


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,153,487
Number of Sequences: 37544
Number of extensions: 524442
Number of successful extensions: 1308
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1274
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1308
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2858396560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).