SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30002
         (748 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_04_0344 + 20442041-20442374,20443115-20443210,20444512-204446...    29   3.9  
09_02_0594 + 11023016-11023053,11023103-11023349,11024590-11024712     28   9.1  

>05_04_0344 +
           20442041-20442374,20443115-20443210,20444512-20444633,
           20444781-20445029,20445300-20445549,20446036-20446262
          Length = 425

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 14/45 (31%), Positives = 26/45 (57%), Gaps = 2/45 (4%)
 Frame = -2

Query: 471 FYSVGSISFSNNVMIVDSNLKSEYSNDTAITLL--NFLKIVVKLY 343
           +  +GS  + NN ++ + N ++EY+ D   TLL   + K + +LY
Sbjct: 226 YVGMGSNDYLNNYLMPNYNTRNEYNGDQYSTLLVQQYTKQLTRLY 270


>09_02_0594 + 11023016-11023053,11023103-11023349,11024590-11024712
          Length = 135

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = +2

Query: 233 WCILPFKLSTDWQTKAQV 286
           W +LPF++ TDW T  Q+
Sbjct: 39  WTMLPFEVETDWLTLTQM 56


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,393,043
Number of Sequences: 37544
Number of extensions: 298463
Number of successful extensions: 468
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 463
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 468
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1980691104
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).