SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30001
         (833 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_03_1291 + 25545749-25546262,25546989-25547669,25547693-255477...    35   0.092
06_02_0297 - 13891954-13892556,13893019-13893855,13894179-138943...    34   0.16 
07_01_0009 - 57820-59457,59537-59650                                   29   6.0  
04_04_1334 - 32723950-32724121,32724527-32724558,32724665-327247...    28   8.0  
02_04_0492 - 23424745-23425890                                         28   8.0  

>07_03_1291 +
           25545749-25546262,25546989-25547669,25547693-25547751,
           25549152-25549242,25549330-25549743,25550191-25550243,
           25550947-25551177,25551492-25551708,25551790-25551890,
           25552446-25552532,25553536-25553676,25553839-25553961,
           25554070-25554522,25554931-25555308,25555410-25556060,
           25556264-25556368,25556482-25556707,25557204-25557241
          Length = 1520

 Score = 34.7 bits (76), Expect = 0.092
 Identities = 21/61 (34%), Positives = 32/61 (52%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L  +G P+  I  I+ L + S   V+   + G  I    G++QG  LSP LFI++ D + 
Sbjct: 59  LSVKGFPDNWISWIKNLLQTSKSAVLLHGIPGKWITCKKGLRQGDPLSPYLFILVADVLQ 118

Query: 527 R 525
           R
Sbjct: 119 R 119


>06_02_0297 -
           13891954-13892556,13893019-13893855,13894179-13894394,
           13895455-13895874,13896198-13896506
          Length = 794

 Score = 33.9 bits (74), Expect = 0.16
 Identities = 23/73 (31%), Positives = 38/73 (52%)
 Frame = -1

Query: 764 LTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGV 585
           L FEK+  T+   A     ++  G P K I  +Q ++  ++  V+ + V G   +   GV
Sbjct: 456 LDFEKAFDTIEHSAILS-VMQHMGFPLKWIEWVQMVFSTASSAVLLNGVPGNSFKCRRGV 514

Query: 584 KQGCLLSPLLFIM 546
           +QG  LS LLF++
Sbjct: 515 RQGVPLSLLLFVL 527


>07_01_0009 - 57820-59457,59537-59650
          Length = 583

 Score = 28.7 bits (61), Expect = 6.0
 Identities = 14/34 (41%), Positives = 19/34 (55%)
 Frame = +2

Query: 566 TGGSPA*HPLSSQ*GLPGLGHARLYMYYLCIRPG 667
           TGG PA     +  G+PGL HA   M++L +  G
Sbjct: 194 TGGQPANSVALTINGMPGLSHAHKEMHHLRVARG 227


>04_04_1334 -
           32723950-32724121,32724527-32724558,32724665-32724708,
           32724962-32725123,32725984-32726422
          Length = 282

 Score = 28.3 bits (60), Expect = 8.0
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = -1

Query: 677 IGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVVTTLGA 501
           IG    L+R   CR  H  +L   + + AG  Q C ++P LF+ ++   M   ++ L A
Sbjct: 128 IGAAGNLFR---CRSFHIGILSGALLVIAGFSQLCNMTPFLFVDIVLGYMFYKLSILAA 183


>02_04_0492 - 23424745-23425890
          Length = 381

 Score = 28.3 bits (60), Expect = 8.0
 Identities = 19/63 (30%), Positives = 25/63 (39%), Gaps = 5/63 (7%)
 Frame = +1

Query: 643 VLPLYKAWIIPMILFGIPLCFKQGPHFAPLYS-----VKTLFSKVNKRKNHFQSANSTLC 807
           V P Y AWI P++L    +      +++P Y        TL    N R         TLC
Sbjct: 50  VSPFYPAWITPLLLSAADVGVTSARYYSPYYHKCFQIADTLVKVPNARICCSTGRRLTLC 109

Query: 808 SMK 816
           S K
Sbjct: 110 SPK 112


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,864,424
Number of Sequences: 37544
Number of extensions: 525459
Number of successful extensions: 1250
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1209
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1250
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2303447664
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).