SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0036
         (648 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_06_0176 + 32158462-32158855,32159960-32160229,32160328-32160998    181   5e-46
06_03_1086 - 27494238-27494914,27495471-27495740,27495986-27496379    180   1e-45
02_01_0499 + 3619909-3620302,3621123-3621392,3621788-3622467          179   2e-45
05_04_0306 + 20058640-20059159,20060406-20060819,20060921-200611...   173   1e-43
01_02_0004 - 10097759-10098438,10098973-10099242,10099956-10100349    173   1e-43
01_06_1060 + 34162161-34162554,34162613-34162675,34163262-341635...   171   3e-43
03_01_0034 + 318432-318825,318902-319851                              171   5e-43
03_05_0575 + 25747813-25748206,25748567-25748614,25750296-257505...   169   1e-42
07_03_0994 + 23190344-23190456,23191367-23191581,23191663-231918...    96   2e-20
11_02_0058 + 7879859-7879951,7880844-7881078,7881165-7881535,788...    96   2e-20
03_05_0974 + 29324025-29324117,29325064-29325298,29325385-293257...    95   6e-20
03_02_0186 - 6243487-6243799,6243892-6244400,6244495-6244557,624...    94   1e-19
05_01_0412 - 3248405-3248458,3248533-3248637,3248950-3249078,324...    73   1e-13
04_03_1017 + 21747044-21748051                                         34   0.085
11_06_0221 - 21387365-21387652,21387892-21389952,21390360-21390395     32   0.45 
10_08_0782 + 20517103-20519601                                         32   0.45 
06_01_0460 + 3276855-3277967                                           32   0.45 
07_03_0615 + 19983003-19983238,19983297-19983558,19983651-199839...    31   0.60 
09_04_0325 + 16689613-16689772,16690043-16690329                       30   1.4  
08_01_0371 - 3284103-3284582                                           29   3.2  
07_03_1432 - 26508135-26508881,26509301-26509708                       29   3.2  
05_07_0014 - 27046329-27046371,27059170-27060017,27060739-27061563     29   3.2  
03_05_1081 + 30235677-30236474                                         29   4.2  
11_06_0703 + 26444128-26446215,26446525-26447226                       28   5.6  
07_03_0597 - 19853533-19853790,19853898-19853933,19854002-19854592     28   5.6  
04_04_1078 - 30655212-30655289,30655614-30655811,30655916-306560...    28   5.6  
11_01_0657 + 5322295-5323367,5323436-5323555,5323743-5323791,532...    28   7.4  
05_01_0511 + 4256220-4256828,4256920-4257175,4257247-4257309,425...    28   7.4  
03_01_0524 + 3943581-3943610,3943889-3944050,3944403-3944637,394...    28   7.4  
02_05_0932 - 32841331-32842242                                         28   7.4  
10_02_0042 + 4493692-4494019,4494428-4494441                           27   9.7  
09_01_0117 + 1808669-1809181,1810038-1810059,1810170-1810223,181...    27   9.7  
06_03_0253 + 18753901-18754278,18754873-18754968,18755167-187553...    27   9.7  
04_04_0212 + 23646043-23646369,23646457-23647304,23647409-23649158     27   9.7  
04_03_0589 - 17604361-17604800,17604887-17604949,17605025-176052...    27   9.7  
02_01_0302 - 2021221-2023305                                           27   9.7  

>03_06_0176 + 32158462-32158855,32159960-32160229,32160328-32160998
          Length = 444

 Score =  181 bits (440), Expect = 5e-46
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEASGG+YVPRAV++DLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEASGGRYVPRAVLMDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL+DSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELIDSVLDVVRKEAENCDCLQGF 133



 Score = 89.8 bits (213), Expect = 2e-18
 Identities = 38/44 (86%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREI+HIQ GQCGNQIGAKFWEVI DEHG+DATG Y+GDSDLQL
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVICDEHGVDATGRYAGDSDLQL 44



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 21/44 (47%), Positives = 22/44 (50%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDR+M TFSV PS K
Sbjct: 131 QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPK 174


>06_03_1086 - 27494238-27494914,27495471-27495740,27495986-27496379
          Length = 446

 Score =  180 bits (437), Expect = 1e-45
 Identities = 79/88 (89%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEASGG+YVPRAV++DLEPGTMDSVRSGP+GQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEASGGRYVPRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL+DSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELIDSVLDVVRKEAENCDCLQGF 133



 Score = 89.0 bits (211), Expect = 3e-18
 Identities = 39/44 (88%), Positives = 40/44 (90%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREI+HIQ GQCGNQIGAKFWEVI DEHGID TG YSGDSDLQL
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVICDEHGIDHTGKYSGDSDLQL 44



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 21/44 (47%), Positives = 22/44 (50%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDR+M TFSV PS K
Sbjct: 131 QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPK 174


>02_01_0499 + 3619909-3620302,3621123-3621392,3621788-3622467
          Length = 447

 Score =  179 bits (436), Expect = 2e-45
 Identities = 79/88 (89%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEASGG++VPRAV++DLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEASGGRFVPRAVLMDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL+DSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELIDSVLDVVRKEAENCDCLQGF 133



 Score = 89.0 bits (211), Expect = 3e-18
 Identities = 39/44 (88%), Positives = 40/44 (90%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREI+HIQ GQCGNQIGAKFWEVI DEHGID TG YSGDSDLQL
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVICDEHGIDHTGKYSGDSDLQL 44



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 21/44 (47%), Positives = 22/44 (50%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDR+M TFSV PS K
Sbjct: 131 QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPK 174


>05_04_0306 +
           20058640-20059159,20060406-20060819,20060921-20061190,
           20062179-20062849
          Length = 624

 Score =  173 bits (420), Expect = 1e-43
 Identities = 75/88 (85%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           R+NVYYNEAS G++VPRAV++DLEPGTMDSVR+GP+GQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 226 RVNVYYNEASCGRFVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGH 285

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL+DSVLDVVRKEAE CDC + F
Sbjct: 286 YTEGAELIDSVLDVVRKEAENCDCLQGF 313



 Score = 83.8 bits (198), Expect = 1e-16
 Identities = 35/44 (79%), Positives = 39/44 (88%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREI+HIQ GQCGNQIG+KFWEV+ DEHGID TG Y+G SDLQL
Sbjct: 181 MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYAGTSDLQL 224



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 21/44 (47%), Positives = 22/44 (50%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDR+M TFSV PS K
Sbjct: 311 QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPK 354


>01_02_0004 - 10097759-10098438,10098973-10099242,10099956-10100349
          Length = 447

 Score =  173 bits (420), Expect = 1e-43
 Identities = 75/88 (85%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           R+NVYYNEAS G++VPRAV++DLEPGTMDSVR+GP+GQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RVNVYYNEASCGRFVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL+DSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELIDSVLDVVRKEAENCDCLQGF 133



 Score = 82.6 bits (195), Expect = 2e-16
 Identities = 35/44 (79%), Positives = 38/44 (86%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREI+HIQ GQCGNQIG+KFWEV+ DEHGID TG Y G SDLQL
Sbjct: 1   MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQL 44



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 21/44 (47%), Positives = 22/44 (50%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDR+M TFSV PS K
Sbjct: 131 QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPK 174


>01_06_1060 +
           34162161-34162554,34162613-34162675,34163262-34163531,
           34163944-34164623
          Length = 468

 Score =  171 bits (417), Expect = 3e-43
 Identities = 74/84 (88%), Positives = 82/84 (97%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           R+NVYYNEAS G++VPRAV++DLEPGTMDSVR+GP+GQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RVNVYYNEASCGRFVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDC 508
           YTEGAEL+DSVLDVVRKEAE CDC
Sbjct: 106 YTEGAELIDSVLDVVRKEAENCDC 129



 Score = 85.8 bits (203), Expect = 3e-17
 Identities = 36/44 (81%), Positives = 40/44 (90%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREI+HIQ GQCGNQIGAKFWEV+ DEHGID TG Y+G+SDLQL
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDLQL 44



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 17/21 (80%), Positives = 18/21 (85%)
 Frame = +1

Query: 580 KIREEYPDRIMNTFSVVPSSK 642
           KIREEYPDR+M TFSV PS K
Sbjct: 175 KIREEYPDRMMLTFSVFPSPK 195


>03_01_0034 + 318432-318825,318902-319851
          Length = 447

 Score =  171 bits (415), Expect = 5e-43
 Identities = 74/88 (84%), Positives = 83/88 (94%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           R+NVYYNEAS G++VPRAV++DLEPGTMDSVRSGP+G IFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RVNVYYNEASCGRFVPRAVLMDLEPGTMDSVRSGPYGHIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL+D+VLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELIDAVLDVVRKEAENCDCLQGF 133



 Score = 86.2 bits (204), Expect = 2e-17
 Identities = 37/44 (84%), Positives = 39/44 (88%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREI+HIQ GQCGNQIGAKFWEV+  EHGIDATG Y GDSDLQL
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYDGDSDLQL 44



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 21/44 (47%), Positives = 22/44 (50%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDR+M TFSV PS K
Sbjct: 131 QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPK 174


>03_05_0575 +
           25747813-25748206,25748567-25748614,25750296-25750565,
           25750658-25751334
          Length = 462

 Score =  169 bits (412), Expect = 1e-42
 Identities = 74/84 (88%), Positives = 81/84 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVY+NEASGG++VPRAV++DLEPGTMDS+RSGP G IFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYFNEASGGRHVPRAVLMDLEPGTMDSLRSGPIGGIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDC 508
           YTEGAEL+DSVLDVVRKEAE CDC
Sbjct: 106 YTEGAELIDSVLDVVRKEAENCDC 129



 Score = 77.4 bits (182), Expect = 9e-15
 Identities = 33/44 (75%), Positives = 36/44 (81%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREI+HIQ GQCGNQIGAKFWEVI  EHG+D TG Y+G S  QL
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVICGEHGVDPTGTYTGTSPQQL 44



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 17/21 (80%), Positives = 18/21 (85%)
 Frame = +1

Query: 580 KIREEYPDRIMNTFSVVPSSK 642
           KIREEYPDR+M TFSV PS K
Sbjct: 170 KIREEYPDRMMLTFSVFPSPK 190


>07_03_0994 +
           23190344-23190456,23191367-23191581,23191663-23191862,
           23192420-23192928,23193048-23193363
          Length = 450

 Score = 96.3 bits (229), Expect = 2e-20
 Identities = 40/80 (50%), Positives = 56/80 (70%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRA+ VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD  LD VRK A+ C
Sbjct: 110 VGKEIVDLCLDRVRKLADNC 129



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 18/40 (45%), Positives = 23/40 (57%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 242
           MREI+ I  GQ G Q+G   WE+   EHGI+  G    D+
Sbjct: 1   MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDT 40


>11_02_0058 +
           7879859-7879951,7880844-7881078,7881165-7881535,
           7881648-7882304
          Length = 451

 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 40/80 (50%), Positives = 56/80 (70%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGDYRQLFHPEQLISGKEDAANNFARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD  LD +RK A+ C
Sbjct: 110 IGKEIVDLCLDRIRKLADNC 129



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 18/39 (46%), Positives = 21/39 (53%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239
           MRE + I  GQ G Q+G   WE+   EHGI   G   GD
Sbjct: 1   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGD 39


>03_05_0974 +
           29324025-29324117,29325064-29325298,29325385-29325755,
           29325864-29326520
          Length = 451

 Score = 94.7 bits (225), Expect = 6e-20
 Identities = 40/80 (50%), Positives = 56/80 (70%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGCYRQLFHPEQLINGKEDAANNFARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD  LD +RK A+ C
Sbjct: 110 IGKEIVDLCLDRIRKLADNC 129



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/39 (46%), Positives = 21/39 (53%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239
           MRE + I  GQ G Q+G   WE+   EHGI A G    D
Sbjct: 1   MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSD 39


>03_02_0186 -
           6243487-6243799,6243892-6244400,6244495-6244557,
           6245482-6245681,6246125-6246519,6246776-6246888
          Length = 530

 Score = 93.9 bits (223), Expect = 1e-19
 Identities = 39/80 (48%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E S GK+VPRA+ VDLEP  +D V++GP+ Q+F P+  +  +  A NN+A+GHYT
Sbjct: 110 NTFFSETSSGKHVPRALFVDLEPTVIDEVKTGPYRQLFHPEQLISYKEDAANNFARGHYT 169

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD  LD +RK A+ C
Sbjct: 170 VGREVVDLCLDRLRKLADNC 189



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/40 (45%), Positives = 22/40 (55%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 242
           MREI+ I  GQ G Q+G   WE+   EHGI   G    D+
Sbjct: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPRDA 40


>05_01_0412 -
           3248405-3248458,3248533-3248637,3248950-3249078,
           3249279-3249353,3249520-3249624,3249714-3249767,
           3249970-3250370,3250583-3250694,3250886-3251086,
           3251844-3251972
          Length = 454

 Score = 73.3 bits (172), Expect = 1e-13
 Identities = 31/90 (34%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAK 430
           R +V++ +A    Y+PRA++VDLEP  ++ +++  +  ++  +N    +   GAGNNWA 
Sbjct: 47  RKDVFFYQADDQHYIPRALLVDLEPRVINGIQNSEYRNLYNHENIFVAEHGGGAGNNWAS 106

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           G Y +G ++VD ++D++ +EA+G D    F
Sbjct: 107 G-YHQGEQVVDDIMDMIDREADGSDSLEGF 135



 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 20/33 (60%), Positives = 24/33 (72%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           REI+ IQ GQCGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITIQVGQCGNQIGMEFWKQLCLEHGIGKDG 35


>04_03_1017 + 21747044-21748051
          Length = 335

 Score = 34.3 bits (75), Expect = 0.085
 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 1/58 (1%)
 Frame = -2

Query: 473 PVPNQ-PVQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLA 303
           P P+  P  PP     SP Y+P    RR + P    A   R   SP +  + PP + A
Sbjct: 59  PSPDYTPASPPHRRAASPDYTPESPPRRAASPDYSPASPPRRAASPDYTPESPPRRAA 116



 Score = 32.3 bits (70), Expect = 0.34
 Identities = 18/52 (34%), Positives = 23/52 (44%)
 Frame = -2

Query: 458 PVQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLA 303
           P  PP     SP YSP    RR + P    A  +R   SP +  + PP + A
Sbjct: 108 PESPPR-RAASPDYSPESPPRRAASPDYTPASPSRRAASPDYTPESPPRRAA 158



 Score = 31.5 bits (68), Expect = 0.60
 Identities = 17/52 (32%), Positives = 21/52 (40%)
 Frame = -2

Query: 458 PVQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLA 303
           P  PP     SP YSP    RR + P    +   R   SP +    PP + A
Sbjct: 180 PESPPRRRAASPDYSPSTPPRRAASPDYSPSTPPRRAASPDYSPSTPPRRAA 231



 Score = 29.9 bits (64), Expect = 1.8
 Identities = 17/52 (32%), Positives = 21/52 (40%)
 Frame = -2

Query: 458 PVQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLA 303
           P  PP     SP YSP    RR + P        R   SP +  + PP + A
Sbjct: 80  PESPPR-RAASPDYSPASPPRRAASPDYTPESPPRRAASPDYSPESPPRRAA 130



 Score = 28.3 bits (60), Expect = 5.6
 Identities = 17/52 (32%), Positives = 21/52 (40%)
 Frame = -2

Query: 458 PVQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLA 303
           P  PP     SP YSP    RR + P    +   R   SP +    PP + A
Sbjct: 195 PSTPPR-RAASPDYSPSTPPRRAASPDYSPSTPPRRAASPDYTPMSPPRRAA 245


>11_06_0221 - 21387365-21387652,21387892-21389952,21390360-21390395
          Length = 794

 Score = 31.9 bits (69), Expect = 0.45
 Identities = 17/41 (41%), Positives = 20/41 (48%)
 Frame = -2

Query: 461 QPVQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTARNGRSP 339
           QP  PP+  V+ PS  PPQ    R+ P  R    A N R P
Sbjct: 281 QPPPPPIV-VMRPSSRPPQPPASRTSPTRRVRVDADNARRP 320


>10_08_0782 + 20517103-20519601
          Length = 832

 Score = 31.9 bits (69), Expect = 0.45
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = -3

Query: 421 VIPRPRLSEDEVVRSEDLPKRPGTD-GVHGSRLKVHHHSSRDVLAP*SFVIVDIDAL 254
           +IPR +L++DE+     LP+    D GV   +  VH+H+ RDVL     +   I+A+
Sbjct: 341 LIPR-KLADDELSGDVGLPEYEVVDKGVETVKEVVHYHAHRDVLKELDSIAEQIEAI 396


>06_01_0460 + 3276855-3277967
          Length = 370

 Score = 31.9 bits (69), Expect = 0.45
 Identities = 18/63 (28%), Positives = 27/63 (42%)
 Frame = +1

Query: 136 STSRRVNAGIRSEQSSGK*SRTSTALTPRVLTAATPTCSLTHQCLL*RSFRGQVRPASCD 315
           +T R+    +RS +  G  +R     +PR   A   TC++ H  LL R     + P   D
Sbjct: 271 ATCRKARRTVRSLKGWGAIARLRDEESPRAAVACIGTCAMLHNVLLAREDHSALAPEETD 330

Query: 316 GGP 324
             P
Sbjct: 331 LPP 333


>07_03_0615 +
           19983003-19983238,19983297-19983558,19983651-19983906,
           19983982-19984044,19984131-19984570
          Length = 418

 Score = 31.5 bits (68), Expect = 0.60
 Identities = 19/56 (33%), Positives = 25/56 (44%)
 Frame = -2

Query: 461 QPVQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLAGRT 294
           +P  PP     +P  +PP + R    P   FAQ A    + + QA G  SQ A  T
Sbjct: 244 RPTPPPHGGFRAPFSTPPSSARPSVVPPTGFAQFAMTQAAHFSQAAGSASQAAVST 299


>09_04_0325 + 16689613-16689772,16690043-16690329
          Length = 148

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 14/19 (73%), Positives = 14/19 (73%), Gaps = 1/19 (5%)
 Frame = +2

Query: 374 FRPDNFVFGQSGAGN-NWA 427
           F PDNFVF QS AG  NWA
Sbjct: 129 FNPDNFVFHQSVAGGINWA 147


>08_01_0371 - 3284103-3284582
          Length = 159

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 15/48 (31%), Positives = 20/48 (41%), Gaps = 1/48 (2%)
 Frame = -2

Query: 416 SPPQTVRRRSCPVGRFAQTARNG-RSPWFQAQGPPSQLAGRTCPLKLR 276
           +PP   +R+ CP  R A   R G RS        PS    R   + +R
Sbjct: 72  APPMLPQRKRCPTNRRAMLRRGGARSGPLNCMASPSSATSRASAMTMR 119


>07_03_1432 - 26508135-26508881,26509301-26509708
          Length = 384

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 33/118 (27%), Positives = 45/118 (38%), Gaps = 7/118 (5%)
 Frame = -2

Query: 473 PVP-NQPVQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLAGR 297
           P P   P  P L     P+Y PP +      PV     T     SP   +  P S  +  
Sbjct: 29  PTPITYPSPPSLSPSTPPTYPPPSSTPPSLAPVSPSPPTTYLPPSPTPPSPAPASP-SPP 87

Query: 296 TCPLKLRYSRH*C------VKLQVGVAAVSTRGVNAVLVRDYFPELCSDLIPALTRLD 141
           +  L++ Y    C      VK  V  A  + RG+ A LVR +F +   +   A   LD
Sbjct: 88  SLGLRVGYYSSSCPKAEQIVKDTVKNAVYTNRGIGAGLVRLFFHDCFVEGCDASVLLD 145


>05_07_0014 - 27046329-27046371,27059170-27060017,27060739-27061563
          Length = 571

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 16/38 (42%), Positives = 20/38 (52%)
 Frame = -2

Query: 467 PNQPVQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTAR 354
           P  PV  P  + +SPSY+P  T    S    RF +TAR
Sbjct: 208 PYSPVYSPYPHPVSPSYTPGHTPVASSRRGPRFIRTAR 245


>03_05_1081 + 30235677-30236474
          Length = 265

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 3/57 (5%)
 Frame = -2

Query: 473 PVPNQPVQPPLCNVLSPSYSPPQTVRRRSCPVGRF---AQTARNGRSPWFQAQGPPS 312
           PV  QPV PP   +  P+ +PP  + + +  V RF    Q     R PW +    P+
Sbjct: 53  PVMGQPVPPPPAQLHDPT-APPSPIAKAAELVTRFREQGQALIAARRPWGEVFRAPA 108


>11_06_0703 + 26444128-26446215,26446525-26447226
          Length = 929

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 4/45 (8%)
 Frame = -2

Query: 248 QVGVAAVSTRGVNAVLVRDY----FPELCSDLIPALTRLDVDDFP 126
           ++ +AA++  G +   V +     FP LC  ++P+L RLD+D+ P
Sbjct: 776 EISLAAMNEGGEDGTTVTEKGEASFPRLC--VLPSLKRLDIDNCP 818


>07_03_0597 - 19853533-19853790,19853898-19853933,19854002-19854592
          Length = 294

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 17/50 (34%), Positives = 24/50 (48%)
 Frame = +3

Query: 465 RYWM*LEKKQKAAIVAGFSANSFSGRRYWIWYGDSFDFQNP*RVSRSYYE 614
           RYW+   K ++  I  GF A    G   WI +G+S     P   S S++E
Sbjct: 46  RYWLGEHKVREHLICDGFLA----GYTSWIHHGESMSTSKPSVASSSHHE 91


>04_04_1078 -
           30655212-30655289,30655614-30655811,30655916-30656086,
           30656172-30656252,30656464-30656565,30656671-30656779,
           30656900-30656965,30657566-30657630,30658386-30658475,
           30658952-30659123,30659831-30659943,30660046-30660219,
           30660300-30660347,30662041-30662205
          Length = 543

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 1/73 (1%)
 Frame = -3

Query: 643 LWNLVPRKTYS*YDLDTLHGFWKSKESPYQIQYL-LPENELAENPATIAAFCFFSNYIQY 467
           LW L   KTY  +  D    F   K S  +  Y+ L +    E    + +F F +  ++Y
Sbjct: 417 LWRLTGNKTYQDWGWDIFQAF--EKNSRIESGYVGLRDVNTGEKDNMMQSF-FLAETLKY 473

Query: 466 RINQFSPLCVMSF 428
               FSP  V+SF
Sbjct: 474 LYLLFSPPSVISF 486


>11_01_0657 +
           5322295-5323367,5323436-5323555,5323743-5323791,
           5323968-5324084,5324200-5324268,5324394-5324488,
           5325183-5325521,5327043-5327084,5327814-5327907,
           5328121-5328190,5328719-5329677
          Length = 1008

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 14/42 (33%), Positives = 21/42 (50%)
 Frame = -2

Query: 512 CNNRSLLLLF*LHPVPNQPVQPPLCNVLSPSYSPPQTVRRRS 387
           CN+ +  LL   HP   +    PLC   +P +SP +   R+S
Sbjct: 506 CNSNAAPLLSSGHPASGRMGPTPLCTHRTPPHSPDEDSWRQS 547


>05_01_0511 +
           4256220-4256828,4256920-4257175,4257247-4257309,
           4257397-4257491
          Length = 340

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 17/54 (31%), Positives = 23/54 (42%)
 Frame = -2

Query: 464 NQPVQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLA 303
           ++P  PP     +P  +PP T      P   FAQ      + + QA G  SQ A
Sbjct: 280 HRPTPPPHRGFRAPFTTPPSTSTPPVVPPTGFAQFGTTQAAHFSQAAGSASQAA 333


>03_01_0524 +
           3943581-3943610,3943889-3944050,3944403-3944637,
           3945626-3945666,3946101-3946145,3947119-3947246,
           3947446-3947554,3947641-3947694
          Length = 267

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 9/29 (31%), Positives = 19/29 (65%)
 Frame = +2

Query: 350 RSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           ++ P+  +   +++ +G SGAGN ++ GH
Sbjct: 64  QANPYWAMMHTNSYKYGYSGAGNYYSYGH 92


>02_05_0932 - 32841331-32842242
          Length = 303

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = -2

Query: 473 PVPNQPVQPPLCNVLSPSYSPPQTVRRRSCP 381
           PVP +  +P  CN LSPS S  ++ R +  P
Sbjct: 50  PVPGRRRRPSQCNNLSPSASSVRSPRLQKTP 80


>10_02_0042 + 4493692-4494019,4494428-4494441
          Length = 113

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 18/54 (33%), Positives = 24/54 (44%)
 Frame = -2

Query: 473 PVPNQPVQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPS 312
           P P  P  PP C   +P  SPP    R   P+  FA+ A    +   +A  PP+
Sbjct: 42  PSPTAPPSPPRCRRRAP-LSPP----RGHPPLAPFAEIASGSSAFGSRAVSPPA 90


>09_01_0117 +
           1808669-1809181,1810038-1810059,1810170-1810223,
           1810684-1810892
          Length = 265

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 24/65 (36%), Positives = 31/65 (47%), Gaps = 4/65 (6%)
 Frame = -2

Query: 467 PNQPVQPPLCNVLSPSYSPPQTVR---RRSCPVGRFAQTARNGRSPWFQ-AQGPPSQLAG 300
           PN+PV  PL + LS S +PP   R   R   P  R + T R   +P  Q  + PP  +A 
Sbjct: 4   PNRPVVVPLLS-LSLSRTPPPRRRLRLRTPTPCHRASTTRRALHTPPHQRTRLPPLSVAP 62

Query: 299 RTCPL 285
              PL
Sbjct: 63  SASPL 67


>06_03_0253 +
           18753901-18754278,18754873-18754968,18755167-18755376,
           18756028-18756093,18756379-18756576,18756616-18756810,
           18756968-18757014,18757147-18757234,18757331-18757681,
           18758593-18759123
          Length = 719

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 14/44 (31%), Positives = 23/44 (52%)
 Frame = -3

Query: 484 SNYIQYRINQFSPLCVMSFRPVIPRPRLSEDEVVRSEDLPKRPG 353
           S Y+++   +F   CV +     PRP+   D+   +E  P+RPG
Sbjct: 51  SYYVKFGSCKFGISCVYNHPD--PRPQHGADDKKPAEQFPRRPG 92


>04_04_0212 + 23646043-23646369,23646457-23647304,23647409-23649158
          Length = 974

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 16/29 (55%), Positives = 20/29 (68%), Gaps = 2/29 (6%)
 Frame = +3

Query: 222 GAYSGDSDL--QLNASMSTITKLQGASTS 302
           GA +GD DL  +L A+  TIT+LQGA  S
Sbjct: 780 GAAAGDGDLAARLAAAEHTITELQGALDS 808


>04_03_0589 -
           17604361-17604800,17604887-17604949,17605025-17605280,
           17605373-17605634,17605739-17605885,17606118-17606236,
           17606373-17606531,17606911-17606947,17607023-17607174
          Length = 544

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 18/56 (32%), Positives = 24/56 (42%)
 Frame = -2

Query: 461 QPVQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLAGRT 294
           +P  P      +P  +PP + R    P   FAQ A    + + QA G  SQ A  T
Sbjct: 370 RPTPPLHGGFRAPFSTPPSSARPSVVPPTGFAQFAMTQAAHFSQAAGSASQAAVST 425


>02_01_0302 - 2021221-2023305
          Length = 694

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -2

Query: 476 HPVPNQPVQPPLCNVLSPSYSPPQT 402
           H  P+ P  PP  +   PS+SPPQ+
Sbjct: 513 HTTPSHP-SPPSSSTAPPSHSPPQS 536


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,233,081
Number of Sequences: 37544
Number of extensions: 433997
Number of successful extensions: 1459
Number of sequences better than 10.0: 36
Number of HSP's better than 10.0 without gapping: 1362
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1451
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1608522592
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).