SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0035
         (648 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_02_0645 - 19666189-19666209,19666330-19666437,19667041-196671...    32   0.34 
10_08_0010 - 14078740-14079270                                         32   0.45 
10_06_0035 - 9896289-9896390,9897394-9897503,9897587-9897715,989...    31   0.60 
12_01_0101 - 779047-779298,779459-779711,779857-780005,780033-78...    31   1.0  
11_01_0101 - 738305-738556,738723-738977,739306-739554,739649-73...    31   1.0  
06_03_1036 + 27053480-27053729,27054616-27054704,27054881-270549...    30   1.8  
10_08_0814 - 20779400-20779487,20779780-20780030,20780528-207808...    29   3.2  
02_05_0813 - 31951168-31951722                                         29   3.2  
11_04_0151 + 14135390-14135630,14135723-14136132                       28   5.6  
06_01_0393 + 2831676-2831876,2831986-2832101,2832340-2832421,283...    28   5.6  
09_04_0164 + 15265878-15268701,15268782-15269200                       28   7.4  
04_04_1529 + 34176547-34177215,34177280-34177320,34178777-34179053     28   7.4  
03_02_0917 + 12372122-12372422,12372487-12372524,12373103-123731...    28   7.4  
12_01_0651 - 5507935-5509638                                           27   9.7  
05_01_0284 - 2205317-2205408,2206310-2206481                           27   9.7  
04_01_0360 - 4720997-4721812                                           27   9.7  
02_05_0427 + 28893726-28893930,28895164-28895210                       27   9.7  

>08_02_0645 -
           19666189-19666209,19666330-19666437,19667041-19667152,
           19667321-19667417,19667809-19667911,19668071-19668152,
           19668519-19668665,19668763-19668863,19669037-19669231
          Length = 321

 Score = 32.3 bits (70), Expect = 0.34
 Identities = 15/56 (26%), Positives = 27/56 (48%), Gaps = 1/56 (1%)
 Frame = +3

Query: 159 ERLPAVARVVGSLHVPPLQMRDQRREILHSCCGCRKPKIPENAL-ECHEYIEDENV 323
           ER   +  +   +   P  +R  R+ +  S  G  +    EN L +C+EY++ EN+
Sbjct: 173 ERERDMINIYAQMFTQPFSLRQARKVLFASKLGLAQSDFSENMLKQCNEYVKQENI 228


>10_08_0010 - 14078740-14079270
          Length = 176

 Score = 31.9 bits (69), Expect = 0.45
 Identities = 26/69 (37%), Positives = 31/69 (44%), Gaps = 3/69 (4%)
 Frame = -3

Query: 601 RRGVVDKPTAANIAAIRC--SSAVKYSRRRLTLGSPPTGVCWMP-LIPTTAGFGSFCWPF 431
           RRG  D   A   +A RC  S+AV+  RR    GS PT VC +  L+   A  G     F
Sbjct: 106 RRGGRDPRVARRASASRCSTSTAVRRFRRLCIRGSTPTTVCILAHLVAAWAHAGELEDHF 165

Query: 430 HGLSGNSSP 404
           H   G   P
Sbjct: 166 HVSVGVQRP 174


>10_06_0035 -
           9896289-9896390,9897394-9897503,9897587-9897715,
           9898734-9898800,9898888-9898970,9899878-9899959,
           9900049-9900125,9900206-9900289,9900368-9900437,
           9900580-9900668,9900921-9901613,9902833-9903142
          Length = 631

 Score = 31.5 bits (68), Expect = 0.60
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = +1

Query: 133 QACVDKYSRKGYQPWQEWSDHYTCHRYRCEIRDGKY 240
           Q CV + +++  +PW  W D+ T    RC ++D KY
Sbjct: 288 QLCVFQVAKESKKPWIWW-DYVTDFHIRCPMKDKKY 322


>12_01_0101 -
           779047-779298,779459-779711,779857-780005,780033-780281,
           780377-780571,780681-780788,780935-781156,781669-781986,
           781988-782615,783059-783135,783161-783267,783491-783619,
           783763-783820,783902-783984,784458-784539,784617-784693,
           784827-784910,784999-785068,785146-785234,785319-786008,
           786485-786797
          Length = 1410

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = +1

Query: 133 QACVDKYSRKGYQPWQEWSDHYTCHRYRCEIRDGKY 240
           Q CV K +++  +PW  W D+ T    RC +++ KY
Sbjct: 288 QVCVYKVAKEHGKPWL-WWDYVTDFAIRCPMKEKKY 322


>11_01_0101 -
           738305-738556,738723-738977,739306-739554,739649-739843,
           739953-740060,740184-740405,740806-741390,741495-741863,
           742423-742529,742755-742883,743027-743084,743166-743248,
           744115-744196,744274-744350,744477-744560,744649-744718,
           744796-744884,744965-745654,746127-746439
          Length = 1338

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = +1

Query: 133 QACVDKYSRKGYQPWQEWSDHYTCHRYRCEIRDGKY 240
           Q CV K +++  +PW  W D+ T    RC +++ KY
Sbjct: 288 QVCVYKVAKEHGKPWL-WWDYVTDFAIRCPMKEKKY 322


>06_03_1036 +
           27053480-27053729,27054616-27054704,27054881-27054950,
           27055145-27055228,27055332-27055408,27055519-27055583,
           27055723-27055765,27055889-27055952,27056126-27056254,
           27056522-27056625,27056724-27056828
          Length = 359

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 11/36 (30%), Positives = 21/36 (58%)
 Frame = +1

Query: 133 QACVDKYSRKGYQPWQEWSDHYTCHRYRCEIRDGKY 240
           Q CV + + +  +PW  W D+   ++ RC +++ KY
Sbjct: 31  QLCVHRVANETGRPWAWW-DYVMDYKIRCSMKEKKY 65


>10_08_0814 -
           20779400-20779487,20779780-20780030,20780528-20780812,
           20781563-20782008,20782095-20782485
          Length = 486

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = -3

Query: 451 GSFCWPFHGLSGNSSPGCPLVCTIL 377
           GSF WPF    G +S GC ++C +L
Sbjct: 435 GSFFWPF---VGGTSSGCFMICIVL 456


>02_05_0813 - 31951168-31951722
          Length = 184

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 1/64 (1%)
 Frame = +2

Query: 338 LCAIALRRR-SKWRENSANQRAAWRTVPR*TMEGPTKRAKSCCCRNERHPADTGRWRAQG 514
           +CA  LR R S     SA+  A+  +V R    G  + A SCC  +    +D     A G
Sbjct: 30  VCAPCLRERLSHLMSASASASASLPSVVR----GEEEEASSCCSSSSEASSDASSSAASG 85

Query: 515 QASP 526
            +SP
Sbjct: 86  SSSP 89


>11_04_0151 + 14135390-14135630,14135723-14136132
          Length = 216

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 16/46 (34%), Positives = 21/46 (45%)
 Frame = -1

Query: 528 PGDA*PWARHRPVSAGCRSFRQQQDLARFVGPSMVYRGTVRQAALW 391
           P  A  WA H+  S   R   QQQ   R  G +  +R  V+ A+ W
Sbjct: 171 PSCASRWAAHQMSSPPARVLHQQQHHNRHSGEARPHRYLVQSASHW 216


>06_01_0393 +
           2831676-2831876,2831986-2832101,2832340-2832421,
           2832515-2832671,2832755-2832848,2833942-2834008,
           2834464-2835009
          Length = 420

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 15/44 (34%), Positives = 21/44 (47%)
 Frame = +1

Query: 94  LVLPALSAEDVSYQACVDKYSRKGYQPWQEWSDHYTCHRYRCEI 225
           + +PA +A   S  AC      +  Q + E S   TCH  RC+I
Sbjct: 266 MTIPAEAASSSSAFACAVAALAEQQQMYGEASSTATCHTSRCDI 309


>09_04_0164 + 15265878-15268701,15268782-15269200
          Length = 1080

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 13/45 (28%), Positives = 23/45 (51%)
 Frame = -3

Query: 610 LHLRRGVVDKPTAANIAAIRCSSAVKYSRRRLTLGSPPTGVCWMP 476
           L+L    ++ P  A+I  +   + +  S   L  G+ PT +CW+P
Sbjct: 401 LNLELNAIEGPIPADIGDVINITLMNLSSNLLN-GTIPTSICWLP 444


>04_04_1529 + 34176547-34177215,34177280-34177320,34178777-34179053
          Length = 328

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 25/72 (34%), Positives = 31/72 (43%), Gaps = 2/72 (2%)
 Frame = +3

Query: 432 KGQQNEPNPAVVGMSGIQQTPVGGEPR-VRRLLEYLTAEEQRMAAILAAVGLSTTPRRRC 608
           KG++  P PA    +          P  V  L   LTAEEQ + A L + G +   RRR 
Sbjct: 8   KGRRVHPAPAQQAQADAAAAAAVVLPAAVLALASALTAEEQEVLAYLLSGGGAAGGRRRR 67

Query: 609 RTA-PDESAPQC 641
           R A P E    C
Sbjct: 68  RGAHPPEMGCGC 79


>03_02_0917 +
           12372122-12372422,12372487-12372524,12373103-12373186,
           12373796-12374504,12374641-12374729,12374834-12374903,
           12374977-12375060,12375097-12375239,12375337-12375418,
           12375605-12375687,12375769-12375835,12376287-12376376,
           12377631-12377737,12377862-12377969
          Length = 684

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 12/37 (32%), Positives = 20/37 (54%)
 Frame = +1

Query: 130 YQACVDKYSRKGYQPWQEWSDHYTCHRYRCEIRDGKY 240
           +Q CV K + +  +PW  W D+      RC +++ KY
Sbjct: 330 HQICVFKAANESGKPWL-WWDYVHDFSIRCPMKEKKY 365


>12_01_0651 - 5507935-5509638
          Length = 567

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 11/29 (37%), Positives = 15/29 (51%)
 Frame = -3

Query: 454 FGSFCWPFHGLSGNSSPGCPLVCTILSPF 368
           F    + F GL  + + GC L CT+  PF
Sbjct: 48  FNILRYSFDGLHDDEARGCFLACTLFPPF 76


>05_01_0284 - 2205317-2205408,2206310-2206481
          Length = 87

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 4/50 (8%)
 Frame = +3

Query: 402 PG-ELFPDKPWKGQQ---NEPNPAVVGMSGIQQTPVGGEPRVRRLLEYLT 539
           PG E   D+ W+ Q+   ++P+P  +G  G  +   GG P V+    ++T
Sbjct: 13  PGIEGIEDECWRSQRAAYSQPSPLRMGQRGYTELGQGGAPMVKLSANFVT 62


>04_01_0360 - 4720997-4721812
          Length = 271

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 15/36 (41%), Positives = 18/36 (50%)
 Frame = +2

Query: 308 RR*ECRIPHVLCAIALRRRSKWRENSANQRAAWRTV 415
           RR + R+  V     LRRR +WRE  A  R    TV
Sbjct: 104 RRKQRRLETVTRRQRLRRRRQWREGKAEARVGEETV 139


>02_05_0427 + 28893726-28893930,28895164-28895210
          Length = 83

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 5/44 (11%)
 Frame = +3

Query: 162 RLPAVARVVGS-----LHVPPLQMRDQRREILHSCCGCRKPKIP 278
           ++P +A V+GS        PPLQ   +++ ++ S CG  + KIP
Sbjct: 33  QIPTIASVIGSESSPPSSQPPLQRGGEKQHVMASSCGGER-KIP 75


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,742,006
Number of Sequences: 37544
Number of extensions: 488451
Number of successful extensions: 1600
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 1535
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1595
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1608522592
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).