SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0034
         (598 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_05_0352 + 28240913-28241362                                         29   3.7  
07_03_0423 + 18035688-18036572,18036659-18036978,18052618-180527...    28   4.9  
07_01_0375 - 2790287-2790675,2790843-2793783                           27   8.6  
07_01_0115 + 851505-852368,852611-852730,853000-853020,853253-85...    27   8.6  
03_01_0250 - 1937650-1939071,1939375-1939468,1939665-1939870,193...    27   8.6  

>02_05_0352 + 28240913-28241362
          Length = 149

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 5/49 (10%)
 Frame = +3

Query: 54  RPASTWIRRNRDTRPLLDTSS----TSP-IIGIRKLLQPKSDSSTQDLI 185
           R  STW   +R +RP + T+S    T P ++G+RK  +P+ +  T +L+
Sbjct: 73  RTCSTWTSLSRTSRPTMATTSGVVKTLPELVGLRK--EPRWEDKTTELL 119


>07_03_0423 +
           18035688-18036572,18036659-18036978,18052618-18052724,
           18053001-18053104,18054129-18054328,18054422-18054522,
           18054695-18054841,18055007-18055166,18055287-18055368,
           18056070-18056336,18056846-18056973,18057513-18057672
          Length = 886

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 17/55 (30%), Positives = 24/55 (43%)
 Frame = +1

Query: 193 SHQVERSLQGPGTKSIYSRIIVSLCHSSLGADRVSKLLLDVSPTKFVFLAQTPFV 357
           S +++  + G  T + Y R  VSL  + LGA  V K     +  K      T FV
Sbjct: 521 SKEIDIIVNGAATTNFYERYDVSLASNVLGAKYVCKFAKKCANLKMFLHISTAFV 575


>07_01_0375 - 2790287-2790675,2790843-2793783
          Length = 1109

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 2/40 (5%)
 Frame = +2

Query: 68   LDKKKQGH--KTSVRYLINISNNRNQEAIAAEIGFFHPRF 181
            LD+  + H     +  LI+ISN+R   AIA   G+  P +
Sbjct: 943  LDEMMEAHVGDFGLAKLIDISNSRTMSAIAGSYGYIAPEY 982


>07_01_0115 +
           851505-852368,852611-852730,853000-853020,853253-853369,
           853466-853555,853730-853837,853897-853932,853933-854022
          Length = 481

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = -2

Query: 240 YRFGSGTLKTAFDLMTTSLSNLGWKNPISAAIAS 139
           +R G  T   AFD MT   +++   NP+ AA++S
Sbjct: 72  FRGGVATRSVAFDEMTPRRASVDVPNPLRAALSS 105


>03_01_0250 -
           1937650-1939071,1939375-1939468,1939665-1939870,
           1939986-1940132
          Length = 622

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 25/94 (26%), Positives = 41/94 (43%), Gaps = 1/94 (1%)
 Frame = +1

Query: 190 GSHQVERSLQGPGTKSIYSRIIV-SLCHSSLGADRVSKLLLDVSPTKFVFLAQTPFVKVI 366
           G H++  S     T  ++  II  SLC + +   R   LL DV   +  F      + + 
Sbjct: 332 GLHKLRVSHGSQFTDLVFHDIIATSLCLTHVSL-RWCNLLTDVGIERLSFNKDLNVLDLR 390

Query: 367 DLEGTVDVQSKAKTQQAKLRFKLLEGKEVSVQAL 468
           D     D   ++ +   KL+   L+G ++S QAL
Sbjct: 391 DCRSLGDEAVRSLSCLPKLQILFLDGSDISDQAL 424


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,437,385
Number of Sequences: 37544
Number of extensions: 341006
Number of successful extensions: 846
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 819
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 846
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1423789920
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).