SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0033
         (698 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_06_0176 + 32158462-32158855,32159960-32160229,32160328-32160998    157   8e-39
06_03_1086 - 27494238-27494914,27495471-27495740,27495986-27496379    157   1e-38
05_04_0306 + 20058640-20059159,20060406-20060819,20060921-200611...   157   1e-38
03_01_0034 + 318432-318825,318902-319851                              157   1e-38
02_01_0499 + 3619909-3620302,3621123-3621392,3621788-3622467          157   1e-38
01_06_1060 + 34162161-34162554,34162613-34162675,34163262-341635...   157   1e-38
01_02_0004 - 10097759-10098438,10098973-10099242,10099956-10100349    157   1e-38
03_05_0575 + 25747813-25748206,25748567-25748614,25750296-257505...   156   1e-38
07_03_0994 + 23190344-23190456,23191367-23191581,23191663-231918...    94   8e-20
11_02_0058 + 7879859-7879951,7880844-7881078,7881165-7881535,788...    90   2e-18
03_05_0974 + 29324025-29324117,29325064-29325298,29325385-293257...    90   2e-18
03_02_0186 - 6243487-6243799,6243892-6244400,6244495-6244557,624...    88   7e-18
05_01_0412 - 3248405-3248458,3248533-3248637,3248950-3249078,324...    62   4e-10
03_06_0775 - 36174098-36174204,36174540-36174594,36174690-361747...    33   0.22 
07_03_0678 - 20637931-20638016,20638187-20639753                       32   0.38 
10_08_0022 - 14225725-14226472,14227997-14228420,14228516-14228573     29   3.5  
05_03_0626 - 16335816-16335917,16336331-16336558,16336694-163369...    29   4.7  

>03_06_0176 + 32158462-32158855,32159960-32160229,32160328-32160998
          Length = 444

 Score =  157 bits (381), Expect = 8e-39
 Identities = 67/85 (78%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G+MS KEVDEQ+ N+QNKNS+YFVEWIPNN K +VCDIPPRGLKMA+TF+GN+T+IQ +
Sbjct: 318 RGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSSVCDIPPRGLKMAATFVGNSTSIQEM 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F+RVSEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FRRVSEQFTAMFRRKAFLHWYTGEG 402



 Score =  157 bits (380), Expect = 1e-38
 Identities = 69/87 (79%), Positives = 79/87 (90%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+T CLRFPGQLN+DLRKLAVN++PFPRLHF+  GFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGE 262
           +DAKNMM A DPRHGRYLT + +FRG+
Sbjct: 294 WDAKNMMCAADPRHGRYLTASAMFRGK 320



 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 25/34 (73%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL++EYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQ 426


>06_03_1086 - 27494238-27494914,27495471-27495740,27495986-27496379
          Length = 446

 Score =  157 bits (380), Expect = 1e-38
 Identities = 69/87 (79%), Positives = 79/87 (90%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+T CLRFPGQLN+DLRKLAVN++PFPRLHF+  GFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGE 262
           +DAKNMM A DPRHGRYLT + +FRG+
Sbjct: 294 WDAKNMMCAADPRHGRYLTASAMFRGK 320



 Score =  155 bits (377), Expect = 2e-38
 Identities = 68/85 (80%), Positives = 78/85 (91%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G+MS KEVDEQ+ N+QNKNS+YFVEWIPNN K +VCDIPP GLKMASTFIGN+T+IQ +
Sbjct: 318 RGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSSVCDIPPIGLKMASTFIGNSTSIQEM 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F+RVSEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FRRVSEQFTAMFRRKAFLHWYTGEG 402



 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 25/34 (73%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL++EYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQ 426


>05_04_0306 +
           20058640-20059159,20060406-20060819,20060921-20061190,
           20062179-20062849
          Length = 624

 Score =  157 bits (380), Expect = 1e-38
 Identities = 69/87 (79%), Positives = 79/87 (90%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+T CLRFPGQLN+DLRKLAVN++PFPRLHF+  GFAPLTSRG+QQYRALTVPELT QM
Sbjct: 414 SGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQM 473

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGE 262
           +DAKNMM A DPRHGRYLT + +FRG+
Sbjct: 474 WDAKNMMCAADPRHGRYLTASAMFRGK 500



 Score =  156 bits (379), Expect = 1e-38
 Identities = 67/85 (78%), Positives = 78/85 (91%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G+MS KEVDEQ+ N+QNKNS+YFVEWIPNN K +VCDIPPRGL MASTF+GN+T+IQ +
Sbjct: 498 RGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFVGNSTSIQEM 557

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F+RVSEQF AMFRRKAFLHWYTGEG
Sbjct: 558 FRRVSEQFTAMFRRKAFLHWYTGEG 582



 Score = 54.4 bits (125), Expect = 8e-08
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 573 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 606


>03_01_0034 + 318432-318825,318902-319851
          Length = 447

 Score =  157 bits (380), Expect = 1e-38
 Identities = 69/87 (79%), Positives = 79/87 (90%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+T CLRFPGQLN+DLRKLAVN++PFPRLHF+  GFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGE 262
           +DAKNMM A DPRHGRYLT + +FRG+
Sbjct: 294 WDAKNMMCAADPRHGRYLTASAMFRGK 320



 Score =  156 bits (378), Expect = 2e-38
 Identities = 68/85 (80%), Positives = 77/85 (90%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G+MS KEVDEQ+ N+QNKNS+YFVEWIPNN K  VCDIPP GLKMASTFIGN+T+IQ +
Sbjct: 318 RGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEM 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F+RVSEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FRRVSEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 8e-08
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>02_01_0499 + 3619909-3620302,3621123-3621392,3621788-3622467
          Length = 447

 Score =  157 bits (380), Expect = 1e-38
 Identities = 69/87 (79%), Positives = 79/87 (90%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+T CLRFPGQLN+DLRKLAVN++PFPRLHF+  GFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGE 262
           +DAKNMM A DPRHGRYLT + +FRG+
Sbjct: 294 WDAKNMMCAADPRHGRYLTASAMFRGK 320



 Score =  157 bits (380), Expect = 1e-38
 Identities = 68/85 (80%), Positives = 78/85 (91%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G+MS KEVDEQ+ N+QNKNS+YFVEWIPNN K +VCDIPP GLKMASTFIGN+T+IQ +
Sbjct: 318 RGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSSVCDIPPNGLKMASTFIGNSTSIQEM 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F+RVSEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FRRVSEQFTAMFRRKAFLHWYTGEG 402



 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 25/34 (73%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL++EYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQ 426


>01_06_1060 +
           34162161-34162554,34162613-34162675,34163262-34163531,
           34163944-34164623
          Length = 468

 Score =  157 bits (380), Expect = 1e-38
 Identities = 69/87 (79%), Positives = 79/87 (90%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+T CLRFPGQLN+DLRKLAVN++PFPRLHF+  GFAPLTSRG+QQYRALTVPELT QM
Sbjct: 255 SGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQM 314

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGE 262
           +DAKNMM A DPRHGRYLT + +FRG+
Sbjct: 315 WDAKNMMCAADPRHGRYLTASAMFRGK 341



 Score =  157 bits (380), Expect = 1e-38
 Identities = 68/85 (80%), Positives = 78/85 (91%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G+MS KEVDEQ+ N+QNKNS+YFVEWIPNN K +VCDIPPRGL MASTFIGN+T+IQ +
Sbjct: 339 RGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEM 398

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F+RVSEQF AMFRRKAFLHWYTGEG
Sbjct: 399 FRRVSEQFTAMFRRKAFLHWYTGEG 423



 Score = 54.4 bits (125), Expect = 8e-08
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 414 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 447


>01_02_0004 - 10097759-10098438,10098973-10099242,10099956-10100349
          Length = 447

 Score =  157 bits (380), Expect = 1e-38
 Identities = 69/87 (79%), Positives = 79/87 (90%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+T CLRFPGQLN+DLRKLAVN++PFPRLHF+  GFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGE 262
           +DAKNMM A DPRHGRYLT + +FRG+
Sbjct: 294 WDAKNMMCAADPRHGRYLTASAMFRGK 320



 Score =  157 bits (380), Expect = 1e-38
 Identities = 68/85 (80%), Positives = 78/85 (91%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G+MS KEVDEQ+ N+QNKNS+YFVEWIPNN K +VCDIPPRGL MASTFIGN+T+IQ +
Sbjct: 318 RGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEM 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F+RVSEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FRRVSEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 8e-08
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>03_05_0575 +
           25747813-25748206,25748567-25748614,25750296-25750565,
           25750658-25751334
          Length = 462

 Score =  156 bits (379), Expect = 1e-38
 Identities = 69/86 (80%), Positives = 78/86 (90%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+T CLRFPGQLN+DLRKLAVN++PFPRLHF+  GFAPLTSRG+QQYRALTVPELT QM
Sbjct: 250 SGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQM 309

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           +DAKNMM A DPRHGRYLT + +FRG
Sbjct: 310 WDAKNMMCAADPRHGRYLTASAMFRG 335



 Score =  152 bits (368), Expect = 3e-37
 Identities = 66/85 (77%), Positives = 76/85 (89%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMS KEVDEQ+ N+QNKNS+YFVEWIPNN K +VCDIPP GL MASTF+GN+T+IQ +
Sbjct: 334 RGRMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPVGLSMASTFVGNSTSIQEM 393

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F+RVSEQF AMFRRKAFLHWYT EG
Sbjct: 394 FRRVSEQFTAMFRRKAFLHWYTSEG 418



 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 25/34 (73%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL++EYQQYQ
Sbjct: 409 AFLHWYTSEGMDEMEFTEAESNMNDLVAEYQQYQ 442


>07_03_0994 +
           23190344-23190456,23191367-23191581,23191663-23191862,
           23192420-23192928,23193048-23193363
          Length = 450

 Score = 94.3 bits (224), Expect = 8e-20
 Identities = 39/103 (37%), Positives = 63/103 (61%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S +TT LRF G +N D+ +   N+VP+PR+HF    +AP+ S     +  L+VPE+T  +
Sbjct: 236 SSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAV 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  +MM  CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK 338



 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 31/97 (31%), Positives = 50/97 (51%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K  +   PP          ++ A 
Sbjct: 316 CLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             I N TA+  +F R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEG 412


>11_02_0058 +
           7879859-7879951,7880844-7881078,7881165-7881535,
           7881648-7882304
          Length = 451

 Score = 89.8 bits (213), Expect = 2e-18
 Identities = 38/103 (36%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S +T  LRF G LN D+ +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSA 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  +MM  CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK 338



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 30/97 (30%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K  +   PP          ++ A 
Sbjct: 316 CLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             I N+T++  +F R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMISNSTSVVEVFSRIDIKFDLMYSKRAFVHWYVGEG 412


>03_05_0974 +
           29324025-29324117,29325064-29325298,29325385-29325755,
           29325864-29326520
          Length = 451

 Score = 89.8 bits (213), Expect = 2e-18
 Identities = 38/103 (36%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S +T  LRF G LN D+ +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSA 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  +MM  CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK 338



 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 30/97 (30%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K  +   PP          ++ A 
Sbjct: 316 CLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPSGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             I N+T++  +F R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMISNSTSVVEVFSRIDHKFDLMYSKRAFVHWYVGEG 412


>03_02_0186 -
           6243487-6243799,6243892-6244400,6244495-6244557,
           6245482-6245681,6246125-6246519,6246776-6246888
          Length = 530

 Score = 87.8 bits (208), Expect = 7e-18
 Identities = 36/103 (34%), Positives = 62/103 (60%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S +TT LRF G +N D+ +   N+VP+PR+HF    +AP+ S     +   +VPE+T  +
Sbjct: 317 SSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPIISVEKAFHEQHSVPEITNSV 376

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  ++M  CDPRHG+Y+    ++RG+ + K + +     +T+
Sbjct: 377 FEPASVMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVHSIKTR 419



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 29/97 (29%), Positives = 50/97 (51%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGL--------KMAS 396
           C   +G +  K+V+  + +I+ + +  FV+W P   K  +   PP  +        + A 
Sbjct: 397 CLMYRGDVVPKDVNAAVHSIKTRRTVQFVDWCPTGFKCGINYQPPTAVPGGDLAKVRRAV 456

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             I N TA+  +F R+  +F  M+ ++AF+HWY GEG
Sbjct: 457 CMISNNTAVAEVFSRIDRKFDLMYAKRAFVHWYVGEG 493


>05_01_0412 -
           3248405-3248458,3248533-3248637,3248950-3249078,
           3249279-3249353,3249520-3249624,3249714-3249767,
           3249970-3250370,3250583-3250694,3250886-3251086,
           3251844-3251972
          Length = 454

 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 33/93 (35%), Positives = 51/93 (54%), Gaps = 6/93 (6%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLT-SRGAQQYRALTVPELTLQ 178
           S  TT LR+PG +N DL  L  +++P PR HF   G+ PLT  R     R  TV ++  +
Sbjct: 237 SASTTTLRYPGYMNNDLVGLLASLIPTPRCHFLMTGYTPLTVERQVNMIRKTTVLDVMRR 296

Query: 179 MFDAKNMMVACDPRH-----GRYLTVATIFRGE 262
           +   KN+MV+   R+      +Y+++  I +GE
Sbjct: 297 LLQTKNIMVSSYARNKEASQAKYISILNIIQGE 329



 Score = 34.7 bits (76), Expect = 0.071
 Identities = 23/82 (28%), Positives = 42/82 (51%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQT 429
           IQG +   +V E L  I+ +    F+EW P + +++       GL +A     N T+I+ 
Sbjct: 326 IQGEVDPTQVHESLQRIRERKLVNFIEWGPASIQVS-------GLMLA-----NHTSIRH 373

Query: 430 IFKRVSEQFVAMFRRKAFLHWY 495
           +F +   Q+  + +++AFL  Y
Sbjct: 374 LFSKCLGQYEKLRKKQAFLDNY 395


>03_06_0775 -
           36174098-36174204,36174540-36174594,36174690-36174741,
           36174947-36175028,36175110-36175204,36175339-36175727
          Length = 259

 Score = 33.1 bits (72), Expect = 0.22
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)
 Frame = -1

Query: 536 LCLRELHFILPSPVYQCKKAFR-LNIATNCSDTLLNM 429
           L +R++H    SPV  CK +   LNIATN  DT  N+
Sbjct: 186 LVIRKIHIFQESPVKPCKFSLEILNIATNLFDTFPNI 222


>07_03_0678 - 20637931-20638016,20638187-20639753
          Length = 550

 Score = 32.3 bits (70), Expect = 0.38
 Identities = 17/40 (42%), Positives = 23/40 (57%)
 Frame = -2

Query: 286 ARQLLS*TFAPEYRRNGQIPPVSRITRDHHVFGVEHLQRQ 167
           A  L++ TFA ++ R G +  V RI R+    GVE LQ Q
Sbjct: 467 ADALVTDTFARDFARRGMLAYVERIQREERSNGVETLQHQ 506


>10_08_0022 - 14225725-14226472,14227997-14228420,14228516-14228573
          Length = 409

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%)
 Frame = -1

Query: 158 QLKLDTVEL-LATSAAQSQGCRNAGAETAPC 69
           +L+LD +   L+T+AA  QGC  A A TA C
Sbjct: 352 ELELDELPADLSTTAAACQGCNFAAATTAAC 382


>05_03_0626 -
           16335816-16335917,16336331-16336558,16336694-16336973,
           16337596-16338560
          Length = 524

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 16/46 (34%), Positives = 20/46 (43%)
 Frame = +1

Query: 61  GCEHGAVSAPAFLHPWLCAADVARSSTVSSFNCTRADAANVRRQKH 198
           G     +SAP    PW+  AD  R    +     RA  AN +RQ H
Sbjct: 14  GLRFNPLSAPP---PWMLLADHGRGDEAAFLEDARAKNANGKRQNH 56


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,819,988
Number of Sequences: 37544
Number of extensions: 367947
Number of successful extensions: 1166
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 1115
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1161
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1792053856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).