SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0032
         (648 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_02_0021 + 11307795-11308093,11308454-11308556,11309623-113099...    33   0.20 
09_01_0050 + 853712-855368,855440-856113                               29   2.4  
03_05_0586 - 25875703-25876332,25876426-25876713,25877064-258771...    29   2.4  
02_04_0379 - 22491069-22491503                                         29   2.4  
07_03_0293 + 16321539-16321893,16322020-16322207,16322881-163229...    28   7.4  

>08_02_0021 +
           11307795-11308093,11308454-11308556,11309623-11309931,
           11310190-11310618
          Length = 379

 Score = 33.1 bits (72), Expect = 0.20
 Identities = 17/47 (36%), Positives = 21/47 (44%)
 Frame = +1

Query: 205 SEEDWHKTRNSF*SXGTRSXGRGELYNGYXGRXHRTSHPLEAAADRR 345
           S ++W   R SF     R  GRG ++  Y GR  R   P    A RR
Sbjct: 120 SMQEWSSERCSFVQEALRGSGRGHIWAFYRGRQRRLGPPPPLPARRR 166


>09_01_0050 + 853712-855368,855440-856113
          Length = 776

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = +2

Query: 326 KPQLIDGILKYGDRVXTMSLPRASAPPGATP 418
           KP    G  ++G +    SLP  S PPGA+P
Sbjct: 622 KPAAAAGAGRFGSKRSAKSLPDLSPPPGASP 652


>03_05_0586 -
           25875703-25876332,25876426-25876713,25877064-25877194,
           25877299-25877812
          Length = 520

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 19/57 (33%), Positives = 22/57 (38%), Gaps = 12/57 (21%)
 Frame = +2

Query: 173 HGPHXPXPSFGQRKTG------------TRRGILFRASERDXQDAANSIMGXVVXNI 307
           HGPH P P FG+   G             R G L+ A  R   D A   +   V NI
Sbjct: 253 HGPHWPLPPFGESSRGPFNILEQRPRFANRHGRLYEADARSFHDLAEHDIRVAVVNI 309


>02_04_0379 - 22491069-22491503
          Length = 144

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 16/51 (31%), Positives = 23/51 (45%)
 Frame = +1

Query: 370 PXDVSAQSFCSARSYAPTRLSTSSTSPILMSD*RLXANCXRRTESWKTGAV 522
           P  +S  SF    S+ P+   T   +P    D R  A+  +R   W+ GAV
Sbjct: 11  PLSLSLPSFFFFFSFLPSHRRTEGAAPAKDDDGRGTASAKQRAAPWRGGAV 61


>07_03_0293 +
           16321539-16321893,16322020-16322207,16322881-16322904,
           16323497-16323550,16323854-16323944,16324715-16324815,
           16324949-16324999,16326626-16326754,16327772-16327834,
           16327928-16328171,16329628-16329776,16329855-16329944,
           16330343-16330477,16330579-16330635,16331079-16331135,
           16332299-16332336,16332532-16332601,16332971-16333207
          Length = 710

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = -2

Query: 596 SMNLAQIXPCL*LSKNLLMALFKLSTAPVFQ 504
           S  LA +   L +S ++L+ALFK ST P F+
Sbjct: 219 STELAPVLGLLMVSVSVLVALFKRSTVPTFK 249


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,037,696
Number of Sequences: 37544
Number of extensions: 227913
Number of successful extensions: 607
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 576
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 607
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1608522592
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).