SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0029
         (499 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

11_03_0128 - 10437407-10438049,10438097-10438272                       29   1.6  
06_01_0816 - 6171189-6171255,6171277-6171441,6172037-6172618,617...    29   2.1  
07_03_1393 - 26245105-26246862                                         28   3.6  
04_03_0633 + 18208116-18208732,18209916-18210129                       28   3.6  
08_02_0157 - 13385589-13385675,13386187-13386357,13386572-133867...    28   4.8  
06_02_0121 + 12080417-12081632,12082428-12082780,12082844-12083776     28   4.8  
04_04_1304 + 32490971-32491552                                         28   4.8  
12_01_0561 + 4550119-4550265,4550716-4550791,4551601-4551668,455...    27   6.3  
02_01_0612 - 4573595-4573699,4574153-4574200,4574653-4575693,457...    27   6.3  
02_02_0406 - 9888167-9888570,9890168-9890248,9892207-9892600           27   8.4  
01_06_0922 - 33022709-33023545                                         27   8.4  

>11_03_0128 - 10437407-10438049,10438097-10438272
          Length = 272

 Score = 29.5 bits (63), Expect = 1.6
 Identities = 14/33 (42%), Positives = 17/33 (51%)
 Frame = -2

Query: 186 SSSRGTEYSTTCRTARRAYSKARMACDTGGKAS 88
           S S  +  STTCRT  RA   +   C TG + S
Sbjct: 132 SRSTASTSSTTCRTCCRATPNSTSPCKTGSRCS 164


>06_01_0816 -
           6171189-6171255,6171277-6171441,6172037-6172618,
           6173451-6173761
          Length = 374

 Score = 29.1 bits (62), Expect = 2.1
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = -1

Query: 76  GLVVLGPEDWSEISVLNWSQKIS 8
           G VV GP  W EI +  WSQ+ S
Sbjct: 42  GRVVAGPYCWQEIDIQEWSQQQS 64


>07_03_1393 - 26245105-26246862
          Length = 585

 Score = 28.3 bits (60), Expect = 3.6
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = -1

Query: 397 HPNHDSEQPPELLKTAVPRTRSEAQRALYVHT 302
           +PN D++  PE L   VP+   +  R LY+ T
Sbjct: 467 YPNLDADTSPEALVDKVPKLIKQPMRNLYIAT 498


>04_03_0633 + 18208116-18208732,18209916-18210129
          Length = 276

 Score = 28.3 bits (60), Expect = 3.6
 Identities = 22/73 (30%), Positives = 29/73 (39%)
 Frame = -2

Query: 288 SLGNGDSVTSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMAC 109
           SLG       NA+A+L+W+ R          G D+  R      T   A R  S+AR   
Sbjct: 25  SLGVPPPPARNAVALLMWLGR-----RGGGAGVDAVDRARRLVRTRHDAARLASEARAVL 79

Query: 108 DTGGKASWLLKAW 70
             G  A  L + W
Sbjct: 80  HGGAAALDLARRW 92


>08_02_0157 -
           13385589-13385675,13386187-13386357,13386572-13386792,
           13390090-13390240,13390682-13390726,13391121-13391330
          Length = 294

 Score = 27.9 bits (59), Expect = 4.8
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = -2

Query: 237 WVWRLTDHLTTASNGSDSSSRGT 169
           WV  L + +TTASN  D+ SR T
Sbjct: 163 WVELLVNEMTTASNMDDAKSRAT 185


>06_02_0121 + 12080417-12081632,12082428-12082780,12082844-12083776
          Length = 833

 Score = 27.9 bits (59), Expect = 4.8
 Identities = 16/36 (44%), Positives = 17/36 (47%)
 Frame = +2

Query: 218 SVSRHTQMRTAMAFEVTLSPFPSDAPLTSMDVERAL 325
           SVS   + R A A     S FPS  P T  DV R L
Sbjct: 139 SVSSRRRARRAAAVTRRSSAFPSSTPPTQEDVRRGL 174


>04_04_1304 + 32490971-32491552
          Length = 193

 Score = 27.9 bits (59), Expect = 4.8
 Identities = 14/35 (40%), Positives = 20/35 (57%)
 Frame = +2

Query: 239 MRTAMAFEVTLSPFPSDAPLTSMDVERALSFAPRT 343
           +RTA A   +L P P  +P  S+D+    S+AP T
Sbjct: 49  IRTAAAASASLPPVPGYSPRMSIDMACTHSWAPYT 83


>12_01_0561 +
           4550119-4550265,4550716-4550791,4551601-4551668,
           4551951-4552039,4552136-4552313,4553096-4553229,
           4553307-4553520,4553601-4553785,4553930-4554025,
           4554105-4554231
          Length = 437

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 14/32 (43%), Positives = 16/32 (50%)
 Frame = +1

Query: 295 SDEYGRRARVELRSAYVAPRSSRALEAVRCRG 390
           SD YG  A V   S Y+AP+ S     VR  G
Sbjct: 58  SDGYGSHACVTPTSRYMAPKGSERYMTVRSNG 89


>02_01_0612 -
           4573595-4573699,4574153-4574200,4574653-4575693,
           4576088-4576164,4576265-4576657,4577230-4577382,
           4577938-4578100
          Length = 659

 Score = 27.5 bits (58), Expect = 6.3
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 1/77 (1%)
 Frame = -2

Query: 468 HGKRKTPFEQRVTILSGQSPTFPNIRTTTANSLQSS*RPRCHVRGAKLNARSTSILVRGA 289
           H     PF    + L G+SP FP++  TT N+ Q++       RG   N    ++ + G 
Sbjct: 415 HSSSADPF----STLVGESPQFPDLGRTT-NTWQTAVPSNIQDRGHNDNMSQATLHMNGP 469

Query: 288 SLGNGDSVT-SNAIAVL 241
            +    S T SN I +L
Sbjct: 470 KIEPVSSFTSSNQIPLL 486


>02_02_0406 - 9888167-9888570,9890168-9890248,9892207-9892600
          Length = 292

 Score = 27.1 bits (57), Expect = 8.4
 Identities = 14/43 (32%), Positives = 23/43 (53%)
 Frame = +3

Query: 339 VRGTAVFKSSGGCSLSWFGCWEMSATGRLIL*LAVRTVFFVFR 467
           + G+ +      CS+  F C+E++A G +I  L   T FF+ R
Sbjct: 170 ILGSTLLALGSSCSVPLFWCYEITAWGLVI--LYAGTAFFLRR 210


>01_06_0922 - 33022709-33023545
          Length = 278

 Score = 27.1 bits (57), Expect = 8.4
 Identities = 16/48 (33%), Positives = 24/48 (50%)
 Frame = +1

Query: 262 SHAVSVPERRSSDEYGRRARVELRSAYVAPRSSRALEAVRCRGSDVGK 405
           +HA+S  +R ++  YG R+R    SA   PR  +   +VR   S   K
Sbjct: 141 AHAISRRDRAAAAAYGVRSRSARASASPPPRREQRDRSVRRSPSPAAK 188


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,945,565
Number of Sequences: 37544
Number of extensions: 234491
Number of successful extensions: 793
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 770
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 793
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1047416480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).