SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0028
         (598 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_02_0121 + 13919496-13919734,13919821-13919982,13920102-13920534     29   2.8  
06_03_0487 - 21352955-21353080,21353164-21353357,21353815-213539...    29   2.8  
04_04_0088 + 22723308-22724480                                         29   2.8  
06_01_0358 + 2573241-2573324,2573509-2573636,2573769-2573971,257...    29   3.7  
02_05_1074 - 33904518-33904697,33904886-33904985,33905085-339053...    29   3.7  
03_02_0830 + 11611588-11611660,11611720-11611952                       28   4.9  
07_01_0975 + 8223269-8224354                                           28   6.5  
03_06_0337 + 33224333-33224479,33224603-33224663,33224740-332247...    28   6.5  
08_02_1019 - 23657175-23658047                                         27   8.6  
03_06_0065 - 31399791-31399874,31399956-31400165,31400407-314005...    27   8.6  

>12_02_0121 + 13919496-13919734,13919821-13919982,13920102-13920534
          Length = 277

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 14/36 (38%), Positives = 17/36 (47%)
 Frame = +1

Query: 178 KCFREGESRRAPSAGPMLPVAAVTRRPRALFHIPTH 285
           K F        PS+GP L  A V+R+PR   H   H
Sbjct: 111 KLFMAAWENDFPSSGPSLGTAKVSRQPRRQSHFDLH 146


>06_03_0487 -
           21352955-21353080,21353164-21353357,21353815-21353973,
           21354117-21354242,21354502-21354704,21354892-21355019,
           21355323-21355565,21356734-21356928
          Length = 457

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 19/69 (27%), Positives = 28/69 (40%), Gaps = 5/69 (7%)
 Frame = -3

Query: 284 WVG--MWNSARGRL--VTAATGSMGPADGA-LLLSPSRKHFLFICVEPGSTPRCPSGTPS 120
           W G  +W    G++    A+ GS G   G    L         +CVEP  +P    G+P 
Sbjct: 297 WTGPEIWKDTAGKVDVFVASVGSGGTLTGVGRYLKMKNPSINIVCVEPSESPVISGGSPG 356

Query: 119 MSPQKGSPA 93
               +G+ A
Sbjct: 357 PHKIQGTGA 365


>04_04_0088 + 22723308-22724480
          Length = 390

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 20/63 (31%), Positives = 30/63 (47%)
 Frame = +1

Query: 97  GDPFCGDIDGVPLGQRGVLPGSTQINRKCFREGESRRAPSAGPMLPVAAVTRRPRALFHI 276
           G PF    DG  L  R + P   + +R+CF +    R+   GP  P+  + RRP  + H+
Sbjct: 78  GPPFIIGADGAFLVIRVIFP--CRSDRRCFTDFFVYRS---GPGTPLLELLRRPYPVKHL 132

Query: 277 PTH 285
             H
Sbjct: 133 SDH 135


>06_01_0358 +
           2573241-2573324,2573509-2573636,2573769-2573971,
           2574129-2574254,2574522-2574680,2574857-2575050,
           2575251-2575376
          Length = 339

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 22/76 (28%), Positives = 29/76 (38%), Gaps = 6/76 (7%)
 Frame = -3

Query: 284 WVG--MWNSARGR--LVTAATGSMGPADGA-LLLSPSRKHFLFICVEPGSTPRCPSGTPS 120
           W G  +W    G+  +  A +G+ G   G    L         ICVEP  +P    G PS
Sbjct: 179 WTGPEIWKDTAGKVDIFVAGSGTGGTISGVGKYLKMKNPAVKVICVEPAESPVISGGKPS 238

Query: 119 MSPQKG-SPASQPYTL 75
               +G  P   P  L
Sbjct: 239 RHKIQGMGPGFVPKNL 254


>02_05_1074 -
           33904518-33904697,33904886-33904985,33905085-33905311,
           33905511-33908384,33908467-33908643,33908786-33909008,
           33909727-33909806,33910657-33910817,33910892-33910937,
           33911129-33911251,33911730-33911804,33911920-33912120
          Length = 1488

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 13/27 (48%), Positives = 16/27 (59%)
 Frame = -3

Query: 254 RLVTAATGSMGPADGALLLSPSRKHFL 174
           R V A + S+GP D  + L P  KHFL
Sbjct: 846 RFVVACSESIGPVDTFVYLFPHLKHFL 872


>03_02_0830 + 11611588-11611660,11611720-11611952
          Length = 101

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 3/46 (6%)
 Frame = -2

Query: 291 LMMGRYVEQCARSSSHR---RYRQHGSSGWRSPALAFTETLPVYLC 163
           L+ GRY+   A +S H    R R  G+     PA++    LP++LC
Sbjct: 3   LLWGRYMCTSALASCHTDPMRARSTGALITEQPAVSLISNLPLHLC 48


>07_01_0975 + 8223269-8224354
          Length = 361

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 18/55 (32%), Positives = 23/55 (41%), Gaps = 1/55 (1%)
 Frame = -3

Query: 245 TAATGSMGPADGALLLSPSRKHFLFICVEPGSTPR-CPSGTPSMSPQKGSPASQP 84
           T   GS G    +   SPS          P  +P   P+G+P+  P  G PAS P
Sbjct: 235 TGYGGSSGSPSSSPSSSPSSSPSGSPSSSPSGSPSGSPAGSPAGGPTAGGPASGP 289


>03_06_0337 +
           33224333-33224479,33224603-33224663,33224740-33224776,
           33225237-33225367,33225447-33225590,33225686-33225776,
           33225973-33226106,33226234-33226373,33227328-33227426,
           33227520-33227602,33227690-33227744,33227826-33227937,
           33228274-33228766,33228881-33229094,33229203-33229273,
           33229733-33229901,33229991-33230120,33230556-33230968,
           33231059-33231262
          Length = 975

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 12/37 (32%), Positives = 17/37 (45%)
 Frame = +1

Query: 130 PLGQRGVLPGSTQINRKCFREGESRRAPSAGPMLPVA 240
           PLG +    G    NR+ F +G  R++      LP A
Sbjct: 814 PLGDQSATDGPDANNRRAFNKGNKRKSHDRSSKLPYA 850


>08_02_1019 - 23657175-23658047
          Length = 290

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 18/52 (34%), Positives = 23/52 (44%), Gaps = 1/52 (1%)
 Frame = +1

Query: 184 FREGESRRAPSAGPMLPVAAVTRRPRALFHIPTHHQL-P*IRSPAAVEHSQQ 336
           F   ES      GP  P +AV+    + +    HHQ  P  R+PA   H QQ
Sbjct: 108 FHRKESESPTGVGPAEP-SAVSPAAISAYGASPHHQFSPYYRTPAGYLHHQQ 158


>03_06_0065 -
           31399791-31399874,31399956-31400165,31400407-31400526,
           31401166-31401225,31401670-31401879,31402512-31402587,
           31403010-31403173,31403254-31403316,31403640-31403727,
           31403810-31404460,31405102-31405149,31405334-31405902
          Length = 780

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = -3

Query: 155 GSTPRCPSGTPSMSPQKGSPASQP 84
           GS+PRC S    M  Q+ SP S P
Sbjct: 307 GSSPRCASPEKIMGSQERSPRSSP 330


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,640,384
Number of Sequences: 37544
Number of extensions: 341713
Number of successful extensions: 1088
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 1045
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1087
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1423789920
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).