SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0027
         (429 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_06_0498 - 34341441-34341575,34341808-34341945,34342019-343421...    27   6.4  
01_06_1664 - 38984545-38984615,38984706-38984802,38985362-389855...    27   6.4  

>03_06_0498 -
           34341441-34341575,34341808-34341945,34342019-34342117,
           34342320-34342400,34342548-34342610,34342717-34342764,
           34343033-34343410,34345413-34345537,34345635-34345701,
           34345797-34345856,34346495-34346621,34346670-34346986
          Length = 545

 Score = 27.1 bits (57), Expect = 6.4
 Identities = 12/44 (27%), Positives = 24/44 (54%)
 Frame = +1

Query: 91  ALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVL 222
           A+++A+ M +  P PRW + + ++    ++ D   KA  A+  L
Sbjct: 259 AVIMAIGMWNLPPSPRWLLLRAVQGKA-SVEDNKKKAIQALRSL 301


>01_06_1664 -
           38984545-38984615,38984706-38984802,38985362-38985523,
           38985736-38985825,38986125-38986226,38986373-38986446,
           38986587-38986615,38986766-38986989
          Length = 282

 Score = 27.1 bits (57), Expect = 6.4
 Identities = 11/26 (42%), Positives = 14/26 (53%)
 Frame = -3

Query: 178 CSCPFFQFS*RSSTWAREQHWSCSKP 101
           CS     FS +   WA E+H +CS P
Sbjct: 126 CSSSSTCFSGKGPFWAHEKHGTCSSP 151


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,282,686
Number of Sequences: 37544
Number of extensions: 199946
Number of successful extensions: 459
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 449
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 459
length of database: 14,793,348
effective HSP length: 75
effective length of database: 11,977,548
effective search space used: 802495716
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).