SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0026
         (399 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

09_02_0338 + 7426999-7428322,7428390-7428646                           28   3.1  
05_03_0618 - 16262826-16263097,16263111-16263183                       27   4.1  
12_01_0357 + 2720860-2721066,2721169-2721384,2721481-2723608,272...    27   5.5  
09_04_0269 + 16265191-16265472,16265574-16266149                       27   5.5  
02_01_0399 - 2905026-2905406,2905522-2905630,2905809-2907475,290...    27   5.5  
05_01_0046 + 320600-320631,320694-320733,320871-320957,321282-32...    27   7.2  
03_05_0636 - 26307847-26307852,26308331-26308726,26308802-26309461     27   7.2  
04_03_0985 - 21438036-21438116,21438373-21438495,21438903-214389...    26   9.5  

>09_02_0338 + 7426999-7428322,7428390-7428646
          Length = 526

 Score = 27.9 bits (59), Expect = 3.1
 Identities = 17/47 (36%), Positives = 20/47 (42%)
 Frame = -2

Query: 146 LMESTDPQCHILQHRRPRLPLMQLEAPCSFNFCSLRAIRRYKSYYVD 6
           LM      C  L HR P L +  L A        L+AI   KSYY +
Sbjct: 397 LMVQHTRNCVTLPHRNPMLVVALLAATLGLVCLLLQAIYTMKSYYCE 443


>05_03_0618 - 16262826-16263097,16263111-16263183
          Length = 114

 Score = 27.5 bits (58), Expect = 4.1
 Identities = 12/26 (46%), Positives = 15/26 (57%)
 Frame = +1

Query: 31  RIARREQKLKEHGASSCISGKRGRRC 108
           R+ARR + LK   +  C  G R RRC
Sbjct: 11  RMARRRRWLKRRRSGHCRCGLRSRRC 36


>12_01_0357 +
           2720860-2721066,2721169-2721384,2721481-2723608,
           2723699-2724124,2724242-2724546,2724660-2724823,
           2724899-2724980
          Length = 1175

 Score = 27.1 bits (57), Expect = 5.5
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = +1

Query: 148 GSRARFQLSGNSGRKHSRCCTS 213
           GSRA F+   NS +KHS+ C +
Sbjct: 865 GSRALFEGGFNSSQKHSKSCAA 886


>09_04_0269 + 16265191-16265472,16265574-16266149
          Length = 285

 Score = 27.1 bits (57), Expect = 5.5
 Identities = 11/20 (55%), Positives = 14/20 (70%)
 Frame = -2

Query: 143 MESTDPQCHILQHRRPRLPL 84
           M  T P C +L++ RPRLPL
Sbjct: 157 MARTGPLCLLLENPRPRLPL 176


>02_01_0399 -
           2905026-2905406,2905522-2905630,2905809-2907475,
           2907650-2907790,2907870-2908043,2908577-2908851,
           2909592-2909755,2910409-2910536,2910628-2910734,
           2911747-2911880,2912266-2912441,2912530-2914257,
           2915084-2915239,2915328-2915486,2915581-2915751,
           2915931-2916047,2916417-2916473,2916565-2916680,
           2916790-2916916,2917862-2917945
          Length = 2056

 Score = 27.1 bits (57), Expect = 5.5
 Identities = 9/15 (60%), Positives = 12/15 (80%)
 Frame = -1

Query: 279 GGYHGSSSHCDTMLP 235
           G +HG +SHC T+LP
Sbjct: 208 GFHHGGTSHCRTLLP 222


>05_01_0046 +
           320600-320631,320694-320733,320871-320957,321282-321378,
           321532-321823,321850-321990,322285-322390
          Length = 264

 Score = 26.6 bits (56), Expect = 7.2
 Identities = 16/55 (29%), Positives = 22/55 (40%)
 Frame = +1

Query: 37  ARREQKLKEHGASSCISGKRGRRCCNIWHWGSVDSISGSRARFQLSGNSGRKHSR 201
           A++ +   E   S    G  G +    W+W   D  SGS + FQ    S    SR
Sbjct: 87  AQKWKNFDEDDCSDTPYGNFGGKRSFTWYWPGEDDESGSPSGFQWRDESQSNKSR 141


>03_05_0636 - 26307847-26307852,26308331-26308726,26308802-26309461
          Length = 353

 Score = 26.6 bits (56), Expect = 7.2
 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 1/39 (2%)
 Frame = +1

Query: 37  ARREQKLKEHG-ASSCISGKRGRRCCNIWHWGSVDSISG 150
           A RE  + ++G A    +   G R  N W  G  DS+SG
Sbjct: 44  ALRESSVSQNGMAPPEPTAHEGHRASNSWSSGDTDSVSG 82


>04_03_0985 -
           21438036-21438116,21438373-21438495,21438903-21438995,
           21439176-21439388,21439589-21439687,21440248-21440317,
           21442549-21442619,21442817-21442954,21443034-21443132,
           21444061-21444144,21444268-21444324,21444594-21444683,
           21444886-21445026,21445778-21445882,21445962-21446114,
           21446215-21446316,21446404-21446562,21447039-21447222,
           21447336-21447418,21447523-21447588,21447736-21447793,
           21447903-21448003,21448269-21448355,21449063-21449185,
           21449285-21449364,21449857-21450066,21450159-21450270,
           21450709-21450927,21451356-21451726,21451866-21451965,
           21452544-21452752,21453232-21453337,21453435-21453767
          Length = 1439

 Score = 26.2 bits (55), Expect = 9.5
 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 1/37 (2%)
 Frame = +1

Query: 127 GSVDSISGSRARFQLSGNSGRKHSRCCTSI-LRKFSG 234
           GS DS+ G + R   + N   K   C T I LRK SG
Sbjct: 668 GSKDSLVGYQVRLDSARNERTKLLFCTTGILLRKLSG 704


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,829,705
Number of Sequences: 37544
Number of extensions: 172484
Number of successful extensions: 365
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 362
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 365
length of database: 14,793,348
effective HSP length: 75
effective length of database: 11,977,548
effective search space used: 682720236
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).