SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0023
         (289 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_07_0070 + 27479654-27479672,27479864-27479922,27480339-274803...   118   1e-27
01_06_0260 - 27959188-27959251,27959342-27959424,27960220-279603...   116   2e-27
07_01_0697 + 5265079-5266281                                           30   0.26 
05_01_0199 + 1434040-1434414,1434808-1435127,1435889-1435928           28   1.1  
07_01_0385 - 2871628-2872131                                           28   1.4  
12_02_0648 + 21490202-21490296,21490547-21490634,21491216-214912...    27   1.8  
09_06_0303 - 22149214-22149474,22150099-22150236,22150856-221511...    26   4.2  
07_03_0039 - 12718972-12720699                                         26   5.6  
02_01_0679 - 5048653-5051394                                           25   7.4  
11_01_0796 - 7000747-7001193                                           25   9.8  
11_01_0401 - 3020606-3020932,3021480-3021626,3021711-3021878,302...    25   9.8  
06_03_0343 + 19750914-19751047,19752091-19752676                       25   9.8  
04_04_1651 - 35057525-35057680,35058302-35058311,35058429-350585...    25   9.8  
03_05_0669 + 26589867-26589927,26590674-26590858,26590950-265910...    25   9.8  
01_02_0071 + 10822008-10822011,10822219-10822364,10822452-108225...    25   9.8  
01_01_0340 + 2727135-2727205,2727470-2727639,2728418-2728506,272...    25   9.8  

>05_07_0070 +
           27479654-27479672,27479864-27479922,27480339-27480378,
           27480477-27480565,27481065-27481147,27481219-27481282
          Length = 117

 Score =  118 bits (283), Expect = 1e-27
 Identities = 50/77 (64%), Positives = 60/77 (77%)
 Frame = +2

Query: 23  KMAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKR 202
           ++ KRTKK GI GKYGTRYGASLRK +KKMEV+QH+KY C FCGK A+KR  VGIW CK 
Sbjct: 25  ELTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKFAVKRKAVGIWGCKD 84

Query: 203 CKRTVAGGAWVFSTTAA 253
           C +  AGGA+  +T +A
Sbjct: 85  CGKVKAGGAYTMNTASA 101


>01_06_0260 -
           27959188-27959251,27959342-27959424,27960220-27960308,
           27960388-27960427,27960938-27960981,27961240-27961288
          Length = 122

 Score =  116 bits (280), Expect = 2e-27
 Identities = 50/74 (67%), Positives = 58/74 (78%)
 Frame = +2

Query: 32  KRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCKR 211
           KRTKK GI GKYGTRYGASLRK +KKMEV+QH+KY C FCGK A+KR  VGIW CK C +
Sbjct: 33  KRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKFAVKRKAVGIWGCKDCGK 92

Query: 212 TVAGGAWVFSTTAA 253
             AGGA+  +T +A
Sbjct: 93  VKAGGAYTMNTASA 106


>07_01_0697 + 5265079-5266281
          Length = 400

 Score = 30.3 bits (65), Expect = 0.26
 Identities = 14/34 (41%), Positives = 17/34 (50%)
 Frame = +2

Query: 158 DAMKRSCVGIWSCKRCKRTVAGGAWVFSTTAAYH 259
           DA++R C G W   +C R   GG   F   A YH
Sbjct: 19  DALQRFC-GAWRDMQCSRRGGGGGDAFVVGAVYH 51


>05_01_0199 + 1434040-1434414,1434808-1435127,1435889-1435928
          Length = 244

 Score = 28.3 bits (60), Expect = 1.1
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 3/33 (9%)
 Frame = +1

Query: 199 AMQEDCSR--RSLGILHYCCLSCRSAV-RRLRE 288
           A  EDC R   + GIL Y C SCR+ V  ++RE
Sbjct: 145 AQDEDCFRWNNAAGILCYGCESCRAGVMEKVRE 177


>07_01_0385 - 2871628-2872131
          Length = 167

 Score = 27.9 bits (59), Expect = 1.4
 Identities = 12/33 (36%), Positives = 15/33 (45%)
 Frame = +2

Query: 134 YTCSFCGKDAMKRSCVGIWSCKRCKRTVAGGAW 232
           + C FC K   K   +G       K  VAGG+W
Sbjct: 47  FPCLFCAKTFRKSQALGGHQNAHRKERVAGGSW 79


>12_02_0648 +
           21490202-21490296,21490547-21490634,21491216-21491260,
           21491355-21491387,21491480-21491557,21491647-21491690,
           21491765-21491805,21492102-21492184,21492261-21492352,
           21492468-21492537,21492838-21492876,21493670-21493687,
           21494586-21494713,21495235-21495358,21495585-21495716,
           21496092-21496223,21496582-21496665
          Length = 441

 Score = 27.5 bits (58), Expect = 1.8
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = +2

Query: 113 EVTQHAKYTCSFCGKDAM 166
           E+ +H KYTC  C K A+
Sbjct: 194 EMVEHNKYTCPICSKTAL 211


>09_06_0303 -
           22149214-22149474,22150099-22150236,22150856-22151100,
           22151344-22151809
          Length = 369

 Score = 26.2 bits (55), Expect = 4.2
 Identities = 21/72 (29%), Positives = 26/72 (36%), Gaps = 1/72 (1%)
 Frame = +2

Query: 5   VSERFTKMAKRTKKVG-ITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCV 181
           +  RF       ++V     K G  Y   L K          AKYT    G  A  RS  
Sbjct: 63  MKSRFEAFKANARQVNEFNKKEGMSYTLGLNKFSDMSYEEFAAKYTGGMPGSIADDRSSA 122

Query: 182 GIWSCKRCKRTV 217
           G  SCK  ++ V
Sbjct: 123 GAVSCKLREKNV 134


>07_03_0039 - 12718972-12720699
          Length = 575

 Score = 25.8 bits (54), Expect = 5.6
 Identities = 16/51 (31%), Positives = 24/51 (47%)
 Frame = -2

Query: 240 ENTQAPPATVLLHRLQDQMPTQERFIASLPQNEQVYFACWVTSIFLTILRR 88
           EN  A     +LH  +D +  QERF   L +  +    C + S+F  IL +
Sbjct: 416 ENKIATKIIAVLHSNRDTL--QERFDCLLERGLEYKMLCQIVSVFPKILNQ 464


>02_01_0679 - 5048653-5051394
          Length = 913

 Score = 25.4 bits (53), Expect = 7.4
 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 6/39 (15%)
 Frame = +3

Query: 18  LPKWPNVPKRLELLANMAHVTV-----PLYVKWSK-RWK 116
           LP    VPK LELLA++  + V      L V+W +  WK
Sbjct: 864 LPSLREVPKGLELLASLKKLNVTMQHHELKVEWERDNWK 902


>11_01_0796 - 7000747-7001193
          Length = 148

 Score = 25.0 bits (52), Expect = 9.8
 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 2/23 (8%)
 Frame = +1

Query: 214 CSRRSLGILH--YCCLSCRSAVR 276
           C RR L +LH   CC++CR  VR
Sbjct: 39  CMRRGL-LLHPASCCIACRVVVR 60


>11_01_0401 -
           3020606-3020932,3021480-3021626,3021711-3021878,
           3021960-3022218,3024469-3024522,3025200-3025375
          Length = 376

 Score = 25.0 bits (52), Expect = 9.8
 Identities = 9/31 (29%), Positives = 14/31 (45%)
 Frame = +2

Query: 140 CSFCGKDAMKRSCVGIWSCKRCKRTVAGGAW 232
           C + G + ++  CV IW+  R       G W
Sbjct: 284 CRYIGPNKLRNFCVDIWNWLRAVPEKLQGKW 314


>06_03_0343 + 19750914-19751047,19752091-19752676
          Length = 239

 Score = 25.0 bits (52), Expect = 9.8
 Identities = 9/21 (42%), Positives = 13/21 (61%)
 Frame = +1

Query: 226 SLGILHYCCLSCRSAVRRLRE 288
           ++ +  YCCL CR  VR  R+
Sbjct: 113 AMAVSVYCCLLCRDRVRSDRD 133


>04_04_1651 -
           35057525-35057680,35058302-35058311,35058429-35058569,
           35058675-35058784,35058907-35059006,35059108-35059308,
           35059674-35059879,35060504-35060716,35060785-35060923,
           35061370-35061606,35061688-35061893,35062664-35062759,
           35062900-35063040
          Length = 651

 Score = 25.0 bits (52), Expect = 9.8
 Identities = 13/45 (28%), Positives = 24/45 (53%)
 Frame = +3

Query: 30  PNVPKRLELLANMAHVTVPLYVKWSKRWK*PNTQSILAHFVVRML 164
           P+   R  L   +A + +P Y  + KR+   NTQ  L+  ++R++
Sbjct: 569 PDTELRESLRLAVAEILLPAYRSFLKRFGLSNTQEFLSLELMRLV 613


>03_05_0669 +
           26589867-26589927,26590674-26590858,26590950-26591045,
           26591128-26591223
          Length = 145

 Score = 25.0 bits (52), Expect = 9.8
 Identities = 7/22 (31%), Positives = 14/22 (63%)
 Frame = +3

Query: 36  VPKRLELLANMAHVTVPLYVKW 101
           +P   EL+   +++ +P+YV W
Sbjct: 84  LPDASELIVGSSYICIPVYVSW 105


>01_02_0071 +
           10822008-10822011,10822219-10822364,10822452-10822544,
           10822722-10822781,10822855-10823127,10823229-10823303,
           10823419-10823475,10823593-10823733,10823813-10823863,
           10823905-10823955,10823956-10824051,10824159-10824242,
           10824330-10824432,10824518-10824600
          Length = 438

 Score = 25.0 bits (52), Expect = 9.8
 Identities = 13/25 (52%), Positives = 16/25 (64%)
 Frame = +2

Query: 80  GASLRKMVKKMEVTQHAKYTCSFCG 154
           GAS+  +VK   V QHAK  C+F G
Sbjct: 415 GASMEFLVKL--VPQHAKKQCAFLG 437


>01_01_0340 +
           2727135-2727205,2727470-2727639,2728418-2728506,
           2729017-2729070,2729310-2729380,2729504-2729585,
           2729678-2729774,2729902-2729972
          Length = 234

 Score = 25.0 bits (52), Expect = 9.8
 Identities = 12/40 (30%), Positives = 20/40 (50%)
 Frame = +3

Query: 45  RLELLANMAHVTVPLYVKWSKRWK*PNTQSILAHFVVRML 164
           R  + + +  +T  L++ W   W  P TQS +  FV  +L
Sbjct: 84  RSPVSSTLPQITGRLFITWGILWSFPETQSYI--FVTSLL 121


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,893,199
Number of Sequences: 37544
Number of extensions: 181300
Number of successful extensions: 457
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 450
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 457
length of database: 14,793,348
effective HSP length: 70
effective length of database: 12,165,268
effective search space used: 304131700
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).