SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0018
         (678 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_06_0326 + 33150599-33150907,33151013-33151104,33151961-331520...    36   0.030
12_02_1159 + 26585042-26585441,26585520-26585608,26585670-265857...    32   0.49 
03_05_0435 - 24259864-24260206,24260302-24260467,24261175-242612...    29   2.6  
04_04_0530 + 26024931-26025923                                         29   3.4  
10_08_0829 - 20871810-20872011,20873226-20873359,20873480-208773...    28   6.0  
05_01_0041 + 281427-281549,281671-281730,281822-281868,282013-28...    28   7.9  
02_04_0391 + 22576839-22577387                                         28   7.9  

>03_06_0326 +
           33150599-33150907,33151013-33151104,33151961-33152057,
           33152585-33152656,33152750-33152812,33152905-33153045,
           33153603-33153698,33154120-33154404,33154692-33154851,
           33154947-33155089,33155688-33155861,33156386-33156652,
           33156737-33156856
          Length = 672

 Score = 35.9 bits (79), Expect = 0.030
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 3/65 (4%)
 Frame = +3

Query: 129 LQDDVND--HGKTLGDLKTMVSKLSQNTVIGPESKLDDWRVPFKRLHQYSTKK-QKEIHA 299
           ++ DV D   GKT  +L+ M S++      G    ++ W    KRLH Y  K   +EIHA
Sbjct: 334 IEGDVKDLLEGKTSTELEEMQSQIESQMRSGTAKVVEYWEAILKRLHIYKAKACLREIHA 393

Query: 300 LFPRE 314
              R+
Sbjct: 394 SILRK 398


>12_02_1159 +
           26585042-26585441,26585520-26585608,26585670-26585720,
           26586189-26586282,26586451-26586512,26586589-26586671,
           26586793-26586901,26587010-26587051,26587152-26587316,
           26588165-26588341,26588820-26588984,26589069-26589332
          Length = 566

 Score = 31.9 bits (69), Expect = 0.49
 Identities = 15/68 (22%), Positives = 35/68 (51%)
 Frame = +3

Query: 132 QDDVNDHGKTLGDLKTMVSKLSQNTVIGPESKLDDWRVPFKRLHQYSTKKQKEIHALFPR 311
           QDD+ +   TLG ++     ++++ ++GP  +L ++ + F   H Y   +  E+  +  +
Sbjct: 305 QDDITNVIVTLGSIQIHNKSVARDIIVGPGDELKEFILSF-CTHNYLIVQDVELKDVIEK 363

Query: 312 ERKTYSHC 335
           +   Y +C
Sbjct: 364 KLNIYCYC 371


>03_05_0435 -
           24259864-24260206,24260302-24260467,24261175-24261241,
           24261553-24261648,24261718-24261898,24262252-24262323,
           24262393-24262505,24262596-24262817,24263262-24263910,
           24264118-24264206,24265932-24266015,24266219-24266358,
           24266522-24266573
          Length = 757

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 15/43 (34%), Positives = 20/43 (46%)
 Frame = +2

Query: 359 LQNQNIIEAAFPISVPPKIIRKRSPRTRKVETPRKTPTLRSHK 487
           L  +N IE+  P++  PK+IR   P     E    TP    HK
Sbjct: 505 LSTRNRIESRNPLAFAPKVIRTCGPGLEFGEDSNATPASSRHK 547


>04_04_0530 + 26024931-26025923
          Length = 330

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 25/93 (26%), Positives = 48/93 (51%), Gaps = 14/93 (15%)
 Frame = +3

Query: 138 DVNDHGKTLGDLKTMVSKL-SQNTVIGPE-----SKLDDWRV-------PFKRLHQYSTK 278
           +++DH + +G+L+T V+ L +Q   +  E     S++D  +         F++L      
Sbjct: 71  EIDDHQRRVGELETEVTDLTAQQLQLEEEHQAWGSEIDSLKAQLQVHGDQFQQLSDQYND 130

Query: 279 KQKEIHALFPRERKTYSH-CQLNQKLRAYKIRT 374
           ++  +  L  + R++  H CQL ++LRA KI T
Sbjct: 131 RRGMMDTLEEQLRESQEHVCQLEEQLRAAKIST 163


>10_08_0829 - 20871810-20872011,20873226-20873359,20873480-20877313,
            20878057-20878177,20878414-20878451,20879096-20879218,
            20879308-20879505,20880270-20880356
          Length = 1578

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 17/72 (23%), Positives = 35/72 (48%)
 Frame = +3

Query: 105  HFEKKLDKLQDDVNDHGKTLGDLKTMVSKLSQNTVIGPESKLDDWRVPFKRLHQYSTKKQ 284
            H E++L++ +    D  KTL  L+  +S L ++  +  +S L +    F+  H+   ++ 
Sbjct: 954  HLEQELEQSKRKTMDFCKTLESLEAKLSSLQEDISLKEQSLLSELENIFQE-HKEHEERI 1012

Query: 285  KEIHALFPRERK 320
              +H L  +  K
Sbjct: 1013 DRVHLLLNKIEK 1024


>05_01_0041 +
           281427-281549,281671-281730,281822-281868,282013-282089,
           285368-285440,286193-286281,286665-286711,286805-286885,
           287011-287179,287381-287600,287679-287744,288194-288310,
           288591-288628,288935-289032
          Length = 434

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 15/40 (37%), Positives = 21/40 (52%)
 Frame = +2

Query: 350 AKSLQNQNIIEAAFPISVPPKIIRKRSPRTRKVETPRKTP 469
           A+    Q   + A P   P    R+RSP +R+VE+PR  P
Sbjct: 245 AEKATKQQPRKPASPQRKPAPSPRRRSPPSRRVESPRCRP 284


>02_04_0391 + 22576839-22577387
          Length = 182

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 15/55 (27%), Positives = 27/55 (49%)
 Frame = +2

Query: 311 RKKNIQPLPIKSKAKSLQNQNIIEAAFPISVPPKIIRKRSPRTRKVETPRKTPTL 475
           ++K+++  P     + +Q  N  E    +  PP ++  R P T   ETP  +P+L
Sbjct: 49  KQKHVEIQPTNKLEQLIQPTNEHEQQQLLQPPPSVL-VREPETAGPETPHPSPSL 102


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,963,593
Number of Sequences: 37544
Number of extensions: 272250
Number of successful extensions: 857
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 837
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 856
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1726796312
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).