SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0017
         (698 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_01_0469 - 4127950-4127988,4127989-4128264,4128845-4130861,413...    30   2.0  
02_01_0750 + 5574707-5576017                                           29   3.5  
05_01_0475 - 3818121-3820565                                           28   6.2  

>08_01_0469 -
           4127950-4127988,4127989-4128264,4128845-4130861,
           4131134-4131987
          Length = 1061

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 19/102 (18%), Positives = 41/102 (40%), Gaps = 1/102 (0%)
 Frame = +1

Query: 337 QEKVCSTTKDVFWDRSKIRLLLKLCLEDRFKNINKQKTLWHDIASHVGTT-GXXXXXXXX 513
           Q+K C    D  WD+   RL+     +   ++     T  +++A+ VG            
Sbjct: 282 QKKRCFVVIDDIWDKDSWRLIRCALQDSNHESRVVTTTRIYEVATQVGEVYKMHPLSHDE 341

Query: 514 XXXXTYIRLLKKNRLGKEIKWVHYNTCEEVFKECKSLPSSFL 639
                Y R++     G+ ++      C+++ K+C  +P + +
Sbjct: 342 SKKLLYTRIISGE--GESLRSTSVEACDKILKKCGGVPLAII 381


>02_01_0750 + 5574707-5576017
          Length = 436

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 15/37 (40%), Positives = 22/37 (59%)
 Frame = -3

Query: 354 TTNFFLWLAIMFLYDYRRFIYVDKLSIFSCFYYDLVS 244
           T  FF++ + +FL   +RFIY+D L    C Y D+ S
Sbjct: 302 TKPFFMYKSKLFLGSQKRFIYIDILDGTVC-YVDIPS 337


>05_01_0475 - 3818121-3820565
          Length = 814

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = +2

Query: 122 LKMDMNNPPNQSYWFVLREDQSNVILS-TNNFVNQNPQ 232
           + +  +NPPN  YW    E  S+ ++S  N  +N NP+
Sbjct: 209 IDLSRSNPPNM-YWSWSSEKSSSALISLLNQLININPE 245


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,369,203
Number of Sequences: 37544
Number of extensions: 302349
Number of successful extensions: 624
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 611
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 624
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1792053856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).