SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0015
         (598 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_06_0176 + 32158462-32158855,32159960-32160229,32160328-32160998    181   4e-46
06_03_1086 - 27494238-27494914,27495471-27495740,27495986-27496379    180   1e-45
02_01_0499 + 3619909-3620302,3621123-3621392,3621788-3622467          179   1e-45
05_04_0306 + 20058640-20059159,20060406-20060819,20060921-200611...   173   1e-43
01_02_0004 - 10097759-10098438,10098973-10099242,10099956-10100349    173   1e-43
01_06_1060 + 34162161-34162554,34162613-34162675,34163262-341635...   171   3e-43
03_01_0034 + 318432-318825,318902-319851                              171   5e-43
03_05_0575 + 25747813-25748206,25748567-25748614,25750296-257505...   169   1e-42
07_03_0994 + 23190344-23190456,23191367-23191581,23191663-231918...    98   4e-21
11_02_0058 + 7879859-7879951,7880844-7881078,7881165-7881535,788...    98   5e-21
03_05_0974 + 29324025-29324117,29325064-29325298,29325385-293257...    97   1e-20
03_02_0186 - 6243487-6243799,6243892-6244400,6244495-6244557,624...    96   2e-20
05_01_0412 - 3248405-3248458,3248533-3248637,3248950-3249078,324...    75   6e-14
04_03_1017 + 21747044-21748051                                         34   0.099
07_03_0615 + 19983003-19983238,19983297-19983558,19983651-199839...    31   0.53 
06_01_0460 + 3276855-3277967                                           31   0.53 
10_08_0782 + 20517103-20519601                                         31   0.70 
09_04_0325 + 16689613-16689772,16690043-16690329                       30   1.2  
11_06_0221 - 21387365-21387652,21387892-21389952,21390360-21390395     30   1.6  
05_07_0014 - 27046329-27046371,27059170-27060017,27060739-27061563     29   2.1  
08_01_0371 - 3284103-3284582                                           29   2.8  
07_03_1432 - 26508135-26508881,26509301-26509708                       29   3.7  
02_05_0932 - 32841331-32842242                                         29   3.7  
11_06_0703 + 26444128-26446215,26446525-26447226                       28   4.9  
10_02_0042 + 4493692-4494019,4494428-4494441                           28   4.9  
08_02_0516 + 18080706-18080760,18081796-18081885,18082479-180825...    28   6.5  
05_01_0511 + 4256220-4256828,4256920-4257175,4257247-4257309,425...    28   6.5  
04_04_0212 + 23646043-23646369,23646457-23647304,23647409-23649158     28   6.5  
04_03_0589 - 17604361-17604800,17604887-17604949,17605025-176052...    28   6.5  
03_05_1081 + 30235677-30236474                                         28   6.5  
03_01_0524 + 3943581-3943610,3943889-3944050,3944403-3944637,394...    28   6.5  
06_03_0253 + 18753901-18754278,18754873-18754968,18755167-187553...    27   8.6  
04_04_1218 - 31822915-31823141,31823418-31823832,31824090-318244...    27   8.6  

>03_06_0176 + 32158462-32158855,32159960-32160229,32160328-32160998
          Length = 444

 Score =  181 bits (440), Expect = 4e-46
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEASGG+YVPRAV++DLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEASGGRYVPRAVLMDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL+DSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELIDSVLDVVRKEAENCDCLQGF 133



 Score = 91.9 bits (218), Expect = 4e-19
 Identities = 39/45 (86%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREI+HIQ GQCGNQIGAKFWEVI DEHG+DATG Y+GDSDLQLE
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVICDEHGVDATGRYAGDSDLQLE 45


>06_03_1086 - 27494238-27494914,27495471-27495740,27495986-27496379
          Length = 446

 Score =  180 bits (437), Expect = 1e-45
 Identities = 79/87 (90%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEASGG+YVPRAV++DLEPGTMDSVRSGP+GQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEASGGRYVPRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL+DSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELIDSVLDVVRKEAENCDCLQGF 133



 Score = 91.1 bits (216), Expect = 6e-19
 Identities = 40/45 (88%), Positives = 41/45 (91%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREI+HIQ GQCGNQIGAKFWEVI DEHGID TG YSGDSDLQLE
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVICDEHGIDHTGKYSGDSDLQLE 45


>02_01_0499 + 3619909-3620302,3621123-3621392,3621788-3622467
          Length = 447

 Score =  179 bits (436), Expect = 1e-45
 Identities = 79/87 (90%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEASGG++VPRAV++DLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEASGGRFVPRAVLMDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL+DSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELIDSVLDVVRKEAENCDCLQGF 133



 Score = 91.1 bits (216), Expect = 6e-19
 Identities = 40/45 (88%), Positives = 41/45 (91%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREI+HIQ GQCGNQIGAKFWEVI DEHGID TG YSGDSDLQLE
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVICDEHGIDHTGKYSGDSDLQLE 45


>05_04_0306 +
           20058640-20059159,20060406-20060819,20060921-20061190,
           20062179-20062849
          Length = 624

 Score =  173 bits (420), Expect = 1e-43
 Identities = 75/87 (86%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           +NVYYNEAS G++VPRAV++DLEPGTMDSVR+GP+GQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 227 VNVYYNEASCGRFVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHY 286

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL+DSVLDVVRKEAE CDCL+ F
Sbjct: 287 TEGAELIDSVLDVVRKEAENCDCLQGF 313



 Score = 85.8 bits (203), Expect = 2e-17
 Identities = 36/45 (80%), Positives = 40/45 (88%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREI+HIQ GQCGNQIG+KFWEV+ DEHGID TG Y+G SDLQLE
Sbjct: 181 MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYAGTSDLQLE 225


>01_02_0004 - 10097759-10098438,10098973-10099242,10099956-10100349
          Length = 447

 Score =  173 bits (420), Expect = 1e-43
 Identities = 75/87 (86%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           +NVYYNEAS G++VPRAV++DLEPGTMDSVR+GP+GQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  VNVYYNEASCGRFVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL+DSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELIDSVLDVVRKEAENCDCLQGF 133



 Score = 84.6 bits (200), Expect = 5e-17
 Identities = 36/45 (80%), Positives = 39/45 (86%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREI+HIQ GQCGNQIG+KFWEV+ DEHGID TG Y G SDLQLE
Sbjct: 1   MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLE 45


>01_06_1060 +
           34162161-34162554,34162613-34162675,34163262-34163531,
           34163944-34164623
          Length = 468

 Score =  171 bits (417), Expect = 3e-43
 Identities = 74/85 (87%), Positives = 83/85 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           +NVYYNEAS G++VPRAV++DLEPGTMDSVR+GP+GQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  VNVYYNEASCGRFVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLR 511
           TEGAEL+DSVLDVVRKEAE CDCL+
Sbjct: 107 TEGAELIDSVLDVVRKEAENCDCLQ 131



 Score = 87.8 bits (208), Expect = 6e-18
 Identities = 37/45 (82%), Positives = 41/45 (91%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREI+HIQ GQCGNQIGAKFWEV+ DEHGID TG Y+G+SDLQLE
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDLQLE 45


>03_01_0034 + 318432-318825,318902-319851
          Length = 447

 Score =  171 bits (415), Expect = 5e-43
 Identities = 74/87 (85%), Positives = 83/87 (95%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           +NVYYNEAS G++VPRAV++DLEPGTMDSVRSGP+G IFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  VNVYYNEASCGRFVPRAVLMDLEPGTMDSVRSGPYGHIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL+D+VLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELIDAVLDVVRKEAENCDCLQGF 133



 Score = 88.2 bits (209), Expect = 4e-18
 Identities = 38/45 (84%), Positives = 40/45 (88%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREI+HIQ GQCGNQIGAKFWEV+  EHGIDATG Y GDSDLQLE
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYDGDSDLQLE 45


>03_05_0575 +
           25747813-25748206,25748567-25748614,25750296-25750565,
           25750658-25751334
          Length = 462

 Score =  169 bits (412), Expect = 1e-42
 Identities = 74/85 (87%), Positives = 82/85 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVY+NEASGG++VPRAV++DLEPGTMDS+RSGP G IFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYFNEASGGRHVPRAVLMDLEPGTMDSLRSGPIGGIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLR 511
           TEGAEL+DSVLDVVRKEAE CDCL+
Sbjct: 107 TEGAELIDSVLDVVRKEAENCDCLQ 131



 Score = 79.4 bits (187), Expect = 2e-15
 Identities = 34/45 (75%), Positives = 37/45 (82%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREI+HIQ GQCGNQIGAKFWEVI  EHG+D TG Y+G S  QLE
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVICGEHGVDPTGTYTGTSPQQLE 45


>07_03_0994 +
           23190344-23190456,23191367-23191581,23191663-23191862,
           23192420-23192928,23193048-23193363
          Length = 450

 Score = 98.3 bits (234), Expect = 4e-21
 Identities = 42/88 (47%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           + N +++E   GK+VPRA+ VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  AFNTFFSETGAGKHVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD  LD VRK A+ C  L+ F
Sbjct: 108 YTVGKEIVDLCLDRVRKLADNCTGLQGF 135



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 18/40 (45%), Positives = 23/40 (57%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 239
           MREI+ I  GQ G Q+G   WE+   EHGI+  G    D+
Sbjct: 1   MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDT 40


>11_02_0058 +
           7879859-7879951,7880844-7881078,7881165-7881535,
           7881648-7882304
          Length = 451

 Score = 97.9 bits (233), Expect = 5e-21
 Identities = 42/88 (47%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           + N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  AFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGDYRQLFHPEQLISGKEDAANNFARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD  LD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIVDLCLDRIRKLADNCTGLQGF 135



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 18/39 (46%), Positives = 21/39 (53%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 236
           MRE + I  GQ G Q+G   WE+   EHGI   G   GD
Sbjct: 1   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGD 39


>03_05_0974 +
           29324025-29324117,29325064-29325298,29325385-29325755,
           29325864-29326520
          Length = 451

 Score = 96.7 bits (230), Expect = 1e-20
 Identities = 42/88 (47%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           + N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  AFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGCYRQLFHPEQLINGKEDAANNFARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD  LD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIVDLCLDRIRKLADNCTGLQGF 135



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/39 (46%), Positives = 21/39 (53%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 236
           MRE + I  GQ G Q+G   WE+   EHGI A G    D
Sbjct: 1   MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSD 39


>03_02_0186 -
           6243487-6243799,6243892-6244400,6244495-6244557,
           6245482-6245681,6246125-6246519,6246776-6246888
          Length = 530

 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 41/88 (46%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           + N +++E S GK+VPRA+ VDLEP  +D V++GP+ Q+F P+  +  +  A NN+A+GH
Sbjct: 108 AFNTFFSETSSGKHVPRALFVDLEPTVIDEVKTGPYRQLFHPEQLISYKEDAANNFARGH 167

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD  LD +RK A+ C  L+ F
Sbjct: 168 YTVGREVVDLCLDRLRKLADNCTGLQGF 195



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/40 (45%), Positives = 22/40 (55%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 239
           MREI+ I  GQ G Q+G   WE+   EHGI   G    D+
Sbjct: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPRDA 40


>05_01_0412 -
           3248405-3248458,3248533-3248637,3248950-3249078,
           3249279-3249353,3249520-3249624,3249714-3249767,
           3249970-3250370,3250583-3250694,3250886-3251086,
           3251844-3251972
          Length = 454

 Score = 74.5 bits (175), Expect = 6e-14
 Identities = 31/88 (35%), Positives = 57/88 (64%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGH 433
           +V++ +A    Y+PRA++VDLEP  ++ +++  +  ++  +N    +   GAGNNWA G 
Sbjct: 49  DVFFYQADDQHYIPRALLVDLEPRVINGIQNSEYRNLYNHENIFVAEHGGGAGNNWASG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           Y +G ++VD ++D++ +EA+G D L  F
Sbjct: 108 YHQGEQVVDDIMDMIDREADGSDSLEGF 135



 Score = 48.4 bits (110), Expect = 4e-06
 Identities = 20/33 (60%), Positives = 24/33 (72%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           REI+ IQ GQCGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITIQVGQCGNQIGMEFWKQLCLEHGIGKDG 35


>04_03_1017 + 21747044-21748051
          Length = 335

 Score = 33.9 bits (74), Expect = 0.099
 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 1/58 (1%)
 Frame = -3

Query: 470 PVPNQ-PVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLA 300
           P P+  P  PP     SP Y+P    RR + P    A   R   SP +  + PP + A
Sbjct: 59  PSPDYTPASPPHRRAASPDYTPESPPRRAASPDYSPASPPRRAASPDYTPESPPRRAA 116



 Score = 31.9 bits (69), Expect = 0.40
 Identities = 18/52 (34%), Positives = 23/52 (44%)
 Frame = -3

Query: 455 PVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLA 300
           P  PP     SP YSP    RR + P    A  +R   SP +  + PP + A
Sbjct: 108 PESPPR-RAASPDYSPESPPRRAASPDYTPASPSRRAASPDYTPESPPRRAA 158



 Score = 31.1 bits (67), Expect = 0.70
 Identities = 17/52 (32%), Positives = 21/52 (40%)
 Frame = -3

Query: 455 PVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLA 300
           P  PP     SP YSP    RR + P    +   R   SP +    PP + A
Sbjct: 180 PESPPRRRAASPDYSPSTPPRRAASPDYSPSTPPRRAASPDYSPSTPPRRAA 231



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 17/52 (32%), Positives = 21/52 (40%)
 Frame = -3

Query: 455 PVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLA 300
           P  PP     SP YSP    RR + P        R   SP +  + PP + A
Sbjct: 80  PESPPR-RAASPDYSPASPPRRAASPDYTPESPPRRAASPDYSPESPPRRAA 130



 Score = 27.9 bits (59), Expect = 6.5
 Identities = 17/52 (32%), Positives = 21/52 (40%)
 Frame = -3

Query: 455 PVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLA 300
           P  PP     SP YSP    RR + P    +   R   SP +    PP + A
Sbjct: 195 PSTPPR-RAASPDYSPSTPPRRAASPDYSPSTPPRRAASPDYTPMSPPRRAA 245


>07_03_0615 +
           19983003-19983238,19983297-19983558,19983651-19983906,
           19983982-19984044,19984131-19984570
          Length = 418

 Score = 31.5 bits (68), Expect = 0.53
 Identities = 19/56 (33%), Positives = 25/56 (44%)
 Frame = -3

Query: 458 QPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLAGRT 291
           +P  PP     +P  +PP + R    P   FAQ A    + + QA G  SQ A  T
Sbjct: 244 RPTPPPHGGFRAPFSTPPSSARPSVVPPTGFAQFAMTQAAHFSQAAGSASQAAVST 299


>06_01_0460 + 3276855-3277967
          Length = 370

 Score = 31.5 bits (68), Expect = 0.53
 Identities = 18/63 (28%), Positives = 27/63 (42%)
 Frame = +1

Query: 133 STSRRVNAGIRSEQSSGK*SRTSTALTPRVLTAATPTCSLKHQCLL*RSFRGQVRPASCD 312
           +T R+    +RS +  G  +R     +PR   A   TC++ H  LL R     + P   D
Sbjct: 271 ATCRKARRTVRSLKGWGAIARLRDEESPRAAVACIGTCAMLHNVLLAREDHSALAPEETD 330

Query: 313 GGP 321
             P
Sbjct: 331 LPP 333


>10_08_0782 + 20517103-20519601
          Length = 832

 Score = 31.1 bits (67), Expect = 0.70
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 1/56 (1%)
 Frame = -1

Query: 418 VIPRPRLSEDEVVRSEDLPKRPGTD-GVHGSRLKVHHHSSRDVLAP*SFVIVDIDA 254
           +IPR +L++DE+     LP+    D GV   +  VH+H+ RDVL     +   I+A
Sbjct: 341 LIPR-KLADDELSGDVGLPEYEVVDKGVETVKEVVHYHAHRDVLKELDSIAEQIEA 395


>09_04_0325 + 16689613-16689772,16690043-16690329
          Length = 148

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 14/19 (73%), Positives = 14/19 (73%), Gaps = 1/19 (5%)
 Frame = +2

Query: 371 FRPDNFVFGQSGAGN-NWA 424
           F PDNFVF QS AG  NWA
Sbjct: 129 FNPDNFVFHQSVAGGINWA 147


>11_06_0221 - 21387365-21387652,21387892-21389952,21390360-21390395
          Length = 794

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 16/41 (39%), Positives = 19/41 (46%)
 Frame = -3

Query: 458 QPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSP 336
           QP  PP+   + PS  PPQ    R+ P  R    A N R P
Sbjct: 281 QPPPPPIV-VMRPSSRPPQPPASRTSPTRRVRVDADNARRP 320


>05_07_0014 - 27046329-27046371,27059170-27060017,27060739-27061563
          Length = 571

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 16/38 (42%), Positives = 20/38 (52%)
 Frame = -3

Query: 464 PNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTAR 351
           P  PV  P  + +SPSY+P  T    S    RF +TAR
Sbjct: 208 PYSPVYSPYPHPVSPSYTPGHTPVASSRRGPRFIRTAR 245


>08_01_0371 - 3284103-3284582
          Length = 159

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 15/48 (31%), Positives = 20/48 (41%), Gaps = 1/48 (2%)
 Frame = -3

Query: 413 SPPQTVRRRSCPVGRFAQTARNG-RSPWFQAQGPPSQLAGRTCPLKLR 273
           +PP   +R+ CP  R A   R G RS        PS    R   + +R
Sbjct: 72  APPMLPQRKRCPTNRRAMLRRGGARSGPLNCMASPSSATSRASAMTMR 119


>07_03_1432 - 26508135-26508881,26509301-26509708
          Length = 384

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 32/118 (27%), Positives = 45/118 (38%), Gaps = 7/118 (5%)
 Frame = -3

Query: 470 PVP-NQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLAGR 294
           P P   P  P L     P+Y PP +      PV     T     SP   +  P S  +  
Sbjct: 29  PTPITYPSPPSLSPSTPPTYPPPSSTPPSLAPVSPSPPTTYLPPSPTPPSPAPASP-SPP 87

Query: 293 TCPLKLRYSRH*CFKLQ------VGVAAVSTRGVNAVLVRDYFPELCSDLIPALTRLD 138
           +  L++ Y    C K +      V  A  + RG+ A LVR +F +   +   A   LD
Sbjct: 88  SLGLRVGYYSSSCPKAEQIVKDTVKNAVYTNRGIGAGLVRLFFHDCFVEGCDASVLLD 145


>02_05_0932 - 32841331-32842242
          Length = 303

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCP 378
           PVP +  +P  CN LSPS S  ++ R +  P
Sbjct: 50  PVPGRRRRPSQCNNLSPSASSVRSPRLQKTP 80


>11_06_0703 + 26444128-26446215,26446525-26447226
          Length = 929

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 4/45 (8%)
 Frame = -3

Query: 245 QVGVAAVSTRGVNAVLVRDY----FPELCSDLIPALTRLDVDDFP 123
           ++ +AA++  G +   V +     FP LC  ++P+L RLD+D+ P
Sbjct: 776 EISLAAMNEGGEDGTTVTEKGEASFPRLC--VLPSLKRLDIDNCP 818


>10_02_0042 + 4493692-4494019,4494428-4494441
          Length = 113

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 18/54 (33%), Positives = 24/54 (44%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPS 309
           P P  P  PP C   +P  SPP    R   P+  FA+ A    +   +A  PP+
Sbjct: 42  PSPTAPPSPPRCRRRAP-LSPP----RGHPPLAPFAEIASGSSAFGSRAVSPPA 90


>08_02_0516 +
           18080706-18080760,18081796-18081885,18082479-18082573,
           18083658-18083726,18083812-18084393
          Length = 296

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 12/25 (48%), Positives = 13/25 (52%)
 Frame = -3

Query: 476 LHPVPNQPVQPPLCNXLSPSYSPPQ 402
           LHP P QP+QP L     P   P Q
Sbjct: 162 LHPQPQQPLQPQLQLHPQPQQQPSQ 186


>05_01_0511 +
           4256220-4256828,4256920-4257175,4257247-4257309,
           4257397-4257491
          Length = 340

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 17/54 (31%), Positives = 23/54 (42%)
 Frame = -3

Query: 461 NQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLA 300
           ++P  PP     +P  +PP T      P   FAQ      + + QA G  SQ A
Sbjct: 280 HRPTPPPHRGFRAPFTTPPSTSTPPVVPPTGFAQFGTTQAAHFSQAAGSASQAA 333


>04_04_0212 + 23646043-23646369,23646457-23647304,23647409-23649158
          Length = 974

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 16/29 (55%), Positives = 20/29 (68%), Gaps = 2/29 (6%)
 Frame = +3

Query: 219 GAYSGDSDL--QLEASMSTITKLQGASTS 299
           GA +GD DL  +L A+  TIT+LQGA  S
Sbjct: 780 GAAAGDGDLAARLAAAEHTITELQGALDS 808


>04_03_0589 -
           17604361-17604800,17604887-17604949,17605025-17605280,
           17605373-17605634,17605739-17605885,17606118-17606236,
           17606373-17606531,17606911-17606947,17607023-17607174
          Length = 544

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 19/53 (35%), Positives = 24/53 (45%), Gaps = 1/53 (1%)
 Frame = -3

Query: 446 PPLCNXL-SPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLAGRT 291
           PPL     +P  +PP + R    P   FAQ A    + + QA G  SQ A  T
Sbjct: 373 PPLHGGFRAPFSTPPSSARPSVVPPTGFAQFAMTQAAHFSQAAGSASQAAVST 425


>03_05_1081 + 30235677-30236474
          Length = 265

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 3/57 (5%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRF---AQTARNGRSPWFQAQGPPS 309
           PV  QPV PP      P+ +PP  + + +  V RF    Q     R PW +    P+
Sbjct: 53  PVMGQPVPPPPAQLHDPT-APPSPIAKAAELVTRFREQGQALIAARRPWGEVFRAPA 108


>03_01_0524 +
           3943581-3943610,3943889-3944050,3944403-3944637,
           3945626-3945666,3946101-3946145,3947119-3947246,
           3947446-3947554,3947641-3947694
          Length = 267

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 9/29 (31%), Positives = 19/29 (65%)
 Frame = +2

Query: 347 RSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           ++ P+  +   +++ +G SGAGN ++ GH
Sbjct: 64  QANPYWAMMHTNSYKYGYSGAGNYYSYGH 92


>06_03_0253 +
           18753901-18754278,18754873-18754968,18755167-18755376,
           18756028-18756093,18756379-18756576,18756616-18756810,
           18756968-18757014,18757147-18757234,18757331-18757681,
           18758593-18759123
          Length = 719

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 14/44 (31%), Positives = 23/44 (52%)
 Frame = -1

Query: 481 SNYIQYRINQFSPLCVMXFRPVIPRPRLSEDEVVRSEDLPKRPG 350
           S Y+++   +F   CV  +    PRP+   D+   +E  P+RPG
Sbjct: 51  SYYVKFGSCKFGISCV--YNHPDPRPQHGADDKKPAEQFPRRPG 92


>04_04_1218 -
           31822915-31823141,31823418-31823832,31824090-31824440,
           31825391-31825549,31825965-31826093,31826257-31826460,
           31827200-31827412,31827547-31830912,31830999-31831150,
           31831912-31832407,31832646-31833456,31833537-31834728,
           31834856-31834922
          Length = 2593

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 14/51 (27%), Positives = 22/51 (43%)
 Frame = +3

Query: 195 DEHGIDATGAYSGDSDLQLEASMSTITKLQGASTSREL*WWTLSLEPWTPS 347
           DEH I     Y  D D Q +  ++   +++ A   RE     + +E W  S
Sbjct: 11  DEHEIVQEDLYLDDDDEQFDVDLNEDNEMEEAEPKREQNLVKVGMEAWNQS 61


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,606,182
Number of Sequences: 37544
Number of extensions: 401515
Number of successful extensions: 1311
Number of sequences better than 10.0: 33
Number of HSP's better than 10.0 without gapping: 1223
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1304
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1423789920
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).