SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0013
         (698 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

09_02_0105 - 4337047-4337079,4337175-4337242,4337323-4337425,433...    52   4e-07
08_02_1361 - 26398987-26399019,26399320-26399387,26399458-263995...    38   0.010
01_05_0329 - 21037980-21038378,21038517-21038737,21038827-210389...    32   0.50 
07_01_1033 + 8958317-8959254,8959438-8959673,8960440-8960486,896...    31   1.2  
11_03_0128 - 10437407-10438049,10438097-10438272                       29   2.7  
10_08_0520 - 18495118-18498237                                         29   3.5  
06_01_0816 - 6171189-6171255,6171277-6171441,6172037-6172618,617...    29   3.5  
01_01_1127 + 8930593-8932681,8932812-8933401                           29   3.5  
09_04_0500 - 18120287-18122233                                         29   4.7  
02_02_0406 - 9888167-9888570,9890168-9890248,9892207-9892600           29   4.7  
08_02_0157 - 13385589-13385675,13386187-13386357,13386572-133867...    28   8.2  
06_01_0326 + 2372176-2373057,2373146-2373610                           28   8.2  
05_06_0224 + 26546066-26546830                                         28   8.2  
01_06_1822 - 40132919-40133208,40134313-40134398,40135067-401355...    28   8.2  

>09_02_0105 -
           4337047-4337079,4337175-4337242,4337323-4337425,
           4337507-4337737,4339307-4339347,4339437-4339473,
           4339603-4339605
          Length = 171

 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 24/34 (70%), Positives = 26/34 (76%)
 Frame = +2

Query: 503 AGNPAKSCKARGSNLRVHFKNXYETAMAIRKMPL 604
           A NP KS KA G +LRVHFKN  ETA AIRK+PL
Sbjct: 8   ANNPTKSSKAMGRDLRVHFKNTRETAFAIRKLPL 41



 Score = 28.3 bits (60), Expect = 6.2
 Identities = 11/18 (61%), Positives = 15/18 (83%)
 Frame = +1

Query: 619 RYLKNVIDKKECIPFRRF 672
           RYL++VI  K+ IPFRR+
Sbjct: 46  RYLEDVIAHKQAIPFRRY 63


>08_02_1361 -
           26398987-26399019,26399320-26399387,26399458-26399560,
           26399658-26399888,26400791-26400826,26400891-26400931,
           26401028-26401064,26401158-26401160
          Length = 183

 Score = 37.5 bits (83), Expect = 0.010
 Identities = 23/48 (47%), Positives = 26/48 (54%), Gaps = 12/48 (25%)
 Frame = +2

Query: 497 TGAGNPAKSCKARGSNLRVHFK------------NXYETAMAIRKMPL 604
           T   NP KS KA G +LRVHFK            N  ETA A+RK+PL
Sbjct: 6   TEPSNPTKSAKAMGRDLRVHFKVIVFARFVQCCSNTRETAFALRKLPL 53



 Score = 28.3 bits (60), Expect = 6.2
 Identities = 11/18 (61%), Positives = 15/18 (83%)
 Frame = +1

Query: 619 RYLKNVIDKKECIPFRRF 672
           RYL++VI  K+ IPFRR+
Sbjct: 58  RYLEDVIAHKQAIPFRRY 75


>01_05_0329 -
           21037980-21038378,21038517-21038737,21038827-21038905,
           21039002-21039071,21039144-21039255,21039359-21039398,
           21039482-21039676,21039925-21040044,21040684-21041106,
           21042386-21042928
          Length = 733

 Score = 31.9 bits (69), Expect = 0.50
 Identities = 15/37 (40%), Positives = 24/37 (64%)
 Frame = -3

Query: 402 IRTTTANSLQSS*RPRCHDAERSSTRALRPYSSEERR 292
           ++T T +   +S RPR  D+E  ++  L PYSSE++R
Sbjct: 442 MQTITDSGEDNSRRPRSGDSEIPNSSKLEPYSSEQQR 478


>07_01_1033 +
           8958317-8959254,8959438-8959673,8960440-8960486,
           8960683-8960733
          Length = 423

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 16/49 (32%), Positives = 22/49 (44%)
 Frame = -2

Query: 292 LGNGDSVTSNAHRVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTAR 146
           L + D  +   H VLI +W     L  A+    ++S G     T RTAR
Sbjct: 10  LADSDGASPPPHWVLIDIWCYIGDLPNATTAESTTSTGLPIKVTFRTAR 58


>11_03_0128 - 10437407-10438049,10438097-10438272
          Length = 272

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 14/33 (42%), Positives = 17/33 (51%)
 Frame = -2

Query: 193 SSSRGTEYSTTCRTARRAYSKARMACDTGGKAS 95
           S S  +  STTCRT  RA   +   C TG + S
Sbjct: 132 SRSTASTSSTTCRTCCRATPNSTSPCKTGSRCS 164


>10_08_0520 - 18495118-18498237
          Length = 1039

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 14/34 (41%), Positives = 19/34 (55%)
 Frame = +2

Query: 320 RARVELRSASWHRGLQELWRLFAVVVRMLGNVGD 421
           RAR+ L  A    G + +W   A+V R LGNV +
Sbjct: 751 RARILLSKARERGGTERVWMKSAIVERELGNVDE 784


>06_01_0816 -
           6171189-6171255,6171277-6171441,6172037-6172618,
           6173451-6173761
          Length = 374

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = -1

Query: 83  GLVVLGPEDWSEISVLNWSQKIS 15
           G VV GP  W EI +  WSQ+ S
Sbjct: 42  GRVVAGPYCWQEIDIQEWSQQQS 64


>01_01_1127 + 8930593-8932681,8932812-8933401
          Length = 892

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 14/34 (41%), Positives = 19/34 (55%)
 Frame = +2

Query: 320 RARVELRSASWHRGLQELWRLFAVVVRMLGNVGD 421
           RAR+ L  A    G + +W   A+V R LGNV +
Sbjct: 656 RARILLSKARERGGTERVWMKSAIVERELGNVDE 689


>09_04_0500 - 18120287-18122233
          Length = 648

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 14/28 (50%), Positives = 17/28 (60%)
 Frame = +2

Query: 275 AVSVPERRSSDEYGRRARVELRSASWHR 358
           AV+V +R  S EY   +R E RS SW R
Sbjct: 2   AVAVLDRSFSSEYPASSRTEGRSCSWKR 29


>02_02_0406 - 9888167-9888570,9890168-9890248,9892207-9892600
          Length = 292

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 19/67 (28%), Positives = 33/67 (49%)
 Frame = +3

Query: 351 GTAVFKSSGGCSLSWFGCWEMSATGRLIL*LAVRTVFFVFRVKYTLIKKREPETLRNHAK 530
           G+ +      CS+  F C+E++A G +I  L   T FF+ R K  +I      T  N   
Sbjct: 172 GSTLLALGSSCSVPLFWCYEITAWGLVI--LYAGTAFFL-RRKAAVILDEGDYTPHNVGL 228

Query: 531 RVVQTSV 551
            +++T++
Sbjct: 229 EMLETTI 235


>08_02_0157 -
           13385589-13385675,13386187-13386357,13386572-13386792,
           13390090-13390240,13390682-13390726,13391121-13391330
          Length = 294

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = -2

Query: 244 WVWRLTDHLTTASNGSDSSSRGT 176
           WV  L + +TTASN  D+ SR T
Sbjct: 163 WVELLVNEMTTASNMDDAKSRAT 185


>06_01_0326 + 2372176-2373057,2373146-2373610
          Length = 448

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 23/79 (29%), Positives = 38/79 (48%)
 Frame = -2

Query: 367 LKTAVPRRGAKLNARSTSILVRGASLGNGDSVTSNAHRVLIWVWRLTDHLTTASNGSDSS 188
           +  +VPR G  +        +RG S G+G SV  +++   IW+    DH+ + SN SD  
Sbjct: 221 IHNSVPRSGGLIRDSMHHFGIRGESDGDGISVMGSSN---IWI----DHV-SMSNCSDGL 272

Query: 187 SRGTEYSTTCRTARRAYSK 131
              T+ ST    +   ++K
Sbjct: 273 IDITDGSTAITISNSHFTK 291


>05_06_0224 + 26546066-26546830
          Length = 254

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 12/46 (26%), Positives = 22/46 (47%)
 Frame = +2

Query: 293 RRSSDEYGRRARVELRSASWHRGLQELWRLFAVVVRMLGNVGDWPL 430
           RR  D YG     + +  + H G+++   + A++ R LG    W +
Sbjct: 23  RRVVDMYGHHVGFKAKVVALHGGIRQARAVHAILSRQLGGEKKWEI 68


>01_06_1822 -
           40132919-40133208,40134313-40134398,40135067-40135566,
           40135708-40135905
          Length = 357

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 3/49 (6%)
 Frame = +3

Query: 258 WAFEVTL--SPFPSDAPLTSMDV-ERALSFAPRRGTAVFKSSGGCSLSW 395
           + FE TL   PF  +    + DV  +A+  A     A F S GGC++SW
Sbjct: 54  FTFEFTLHTDPFQVNYRAVAADVISKAVIVAVIGAWARFMSKGGCAVSW 102


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,861,924
Number of Sequences: 37544
Number of extensions: 371902
Number of successful extensions: 995
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 962
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 994
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1792053856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).