SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0010
         (598 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_03_0658 + 18447986-18448117,18448204-18448317,18448388-184485...    31   0.92 
06_03_1450 + 30246702-30247346,30248603-30248689,30248789-302489...    28   6.5  

>04_03_0658 +
           18447986-18448117,18448204-18448317,18448388-18448507,
           18448589-18449215,18449289-18449462,18449545-18449809,
           18449889-18449959,18450043-18450145,18450221-18450280,
           18450533-18450744,18450830-18450901,18451446-18451502,
           18451598-18451882,18452359-18452371,18452396-18452463,
           18452649-18452747,18452836-18452967,18453038-18453141,
           18453234-18453423,18453519-18453524
          Length = 967

 Score = 30.7 bits (66), Expect = 0.92
 Identities = 17/49 (34%), Positives = 24/49 (48%)
 Frame = +3

Query: 231 DSNGIRLLDKYSFXCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKN 377
           D+N    +DK S  C   D++ DE  D+T  + P DN    ID  +  N
Sbjct: 467 DTNLSSEVDKLSKSCNPTDQNNDEKNDVTSAHSPKDNMDNDIDDNRNAN 515


>06_03_1450 +
           30246702-30247346,30248603-30248689,30248789-30248920,
           30249016-30249162,30250375-30250440,30250519-30250629,
           30251551-30251584,30251667-30251743,30251829-30251906
          Length = 458

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 1/43 (2%)
 Frame = -3

Query: 365 LRVYYLNRIVKWKIIEG*IFYFVSILIIHFTXETIFIK-*SYT 240
           LR+Y L  + +W +++  IF F S   + F    I +K  SYT
Sbjct: 232 LRIYPLETVTRWDVLDSSIFAFWSKSSVDFEARRIRLKSNSYT 274


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,767,303
Number of Sequences: 37544
Number of extensions: 238821
Number of successful extensions: 457
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 450
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 457
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1423789920
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).