SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0009
         (698 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_01_0750 + 5574707-5576017                                           29   3.5  
02_03_0199 + 16263549-16263644,16264941-16265899,16267140-162677...    29   4.7  
05_01_0475 - 3818121-3820565                                           28   6.2  
02_02_0206 - 7771835-7771913,7772083-7772219,7772364-7772422,777...    28   6.2  

>02_01_0750 + 5574707-5576017
          Length = 436

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 15/37 (40%), Positives = 22/37 (59%)
 Frame = -3

Query: 354 TTNFFLWLAIMFLYDYRRFIYVDKLSIFSCFYYDLVS 244
           T  FF++ + +FL   +RFIY+D L    C Y D+ S
Sbjct: 302 TKPFFMYKSKLFLGSQKRFIYIDILDGTVC-YVDIPS 337


>02_03_0199 +
           16263549-16263644,16264941-16265899,16267140-16267791,
           16267895-16267981,16268253-16268381,16269990-16270036,
           16271337-16271438,16272720-16272843,16272981-16273028,
           16273934-16274026,16274325-16274408,16274536-16274619,
           16274751-16274819,16275531-16275590,16275946-16276017,
           16276957-16277064,16278162-16278238,16278391-16278474,
           16278617-16278728,16278778-16278810,16278811-16278900,
           16279012-16279077,16279163-16279258,16279446-16279497,
           16279723-16279775,16279998-16280018
          Length = 1165

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 12/18 (66%), Positives = 16/18 (88%)
 Frame = -1

Query: 659 FGSPQVSRKEEGSDLHSL 606
           FG+P + R+EEGSD+HSL
Sbjct: 123 FGNPNM-RREEGSDMHSL 139


>05_01_0475 - 3818121-3820565
          Length = 814

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = +2

Query: 122 LKMDMNNPPNQSYWFVLREDQSNVILS-TNNFVNQNPQ 232
           + +  +NPPN  YW    E  S+ ++S  N  +N NP+
Sbjct: 209 IDLSRSNPPNM-YWSWSSEKSSSALISLLNQLININPE 245


>02_02_0206 -
           7771835-7771913,7772083-7772219,7772364-7772422,
           7772535-7772610,7772717-7772873,7773241-7773329,
           7773648-7773750,7773919-7774013,7774301-7774367,
           7774894-7775066
          Length = 344

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 3/33 (9%)
 Frame = +1

Query: 562 KEIQMGAYNTCEEVFKECKSLPS---SFLETWG 651
           KE+    YNT   VFK  K+  +   SF +TWG
Sbjct: 238 KEVFSSIYNTLRHVFKYVKAYTAHVPSFADTWG 270


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,774,674
Number of Sequences: 37544
Number of extensions: 311170
Number of successful extensions: 584
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 571
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 584
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1792053856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).