SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0005
         (698 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_07_0220 + 28482589-28483752                                         73   3e-13
01_06_0049 - 25953811-25954131,25954223-25954903                       69   3e-12
03_02_0709 + 10583621-10583626,10583711-10584712,10585304-10585669     66   3e-11
08_01_0395 - 3502750-3503033,3504844-3505663                           46   4e-05
08_02_1097 + 24284494-24284496,24284946-24285407,24285476-242864...    43   3e-04
07_01_0287 - 2094333-2094542,2094719-2095999                           42   6e-04
06_03_0766 - 24425486-24426245,24430766-24430855,24430951-244310...    40   0.002
04_04_1500 + 34010819-34011016,34013267-34013308,34014195-340142...    40   0.002
02_01_0703 + 5251901-5251950,5252783-5253554                           39   0.003
04_01_0021 + 311914-312399,314218-314310,314391-314672,314754-31...    34   0.094
01_01_0521 - 3826257-3826616,3826758-3826918,3826992-3827049,382...    34   0.094
07_03_0944 + 22787933-22789906                                         34   0.12 
02_02_0568 + 11577804-11578676,11578956-11579042,11579043-11579141     34   0.12 
09_03_0048 + 11880848-11880952,11881030-11881312,11882667-118827...    32   0.50 
10_07_0063 - 12502305-12503361,12503567-12503668,12504251-125043...    31   0.67 
02_04_0624 + 24538095-24538183,24538429-24538612,24538725-245388...    31   1.2  
08_01_0824 - 8000829-8001272                                           30   1.5  
06_03_1309 + 29223197-29223240,29223358-29223592,29223695-292237...    30   2.0  
05_01_0212 + 1601861-1603600                                           30   2.0  
11_01_0676 - 5511755-5511831,5512857-5513052,5513462-5513577,551...    29   3.5  
07_03_1620 - 28180020-28180862                                         29   3.5  
06_01_1176 + 10112257-10113126                                         29   3.5  
03_06_0186 - 32197461-32197751,32204940-32205548,32205603-32207009     29   3.5  
03_05_0918 - 28785233-28786613,28786894-28787140,28787773-28788238     29   3.5  
01_01_1089 - 8560008-8560220,8560456-8560977,8561095-8561283,856...    29   3.5  
12_02_1133 - 26368323-26369457,26369556-26369635,26370145-263702...    29   4.7  
10_05_0067 + 8756044-8756075,8756180-8756357,8756800-8757471           29   4.7  
09_03_0031 + 11735431-11735728,11736704-11737041,11737150-117372...    29   4.7  
06_03_1121 + 27767707-27768065,27768612-27769034,27770013-277701...    29   4.7  
01_06_1805 - 39999987-40000169,40000648-40000974,40001724-400020...    29   4.7  
06_03_0512 + 21633594-21633890                                         28   6.2  
04_04_0372 + 24781572-24781612,24781696-24782413                       28   6.2  
03_05_0865 - 28365430-28367640                                         28   6.2  
01_04_0146 - 16711102-16711288,16712038-16712760,16712848-16712888     28   6.2  
06_03_0867 + 25534760-25539620,25540662-25540857,25540957-255411...    28   8.2  
05_06_0141 - 25964706-25965473                                         28   8.2  
05_04_0306 + 20058640-20059159,20060406-20060819,20060921-200611...    28   8.2  
05_03_0474 + 14481063-14481403,14481597-14481710,14483428-144836...    28   8.2  
03_05_0618 + 26177743-26178420,26179477-26179617                       28   8.2  
01_05_0024 - 17262504-17263308,17264251-17264399,17264879-172649...    28   8.2  

>05_07_0220 + 28482589-28483752
          Length = 387

 Score = 72.5 bits (170), Expect = 3e-13
 Identities = 30/50 (60%), Positives = 36/50 (72%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           CQFAHGV ELR + RHP+YKT++CR   + G CPYG RCHF H+   A R
Sbjct: 333 CQFAHGVAELRPVIRHPRYKTQVCRMVLAGGVCPYGHRCHFRHSITPADR 382



 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 15/31 (48%), Positives = 18/31 (58%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +KTELC  +   G CPYG +C F H   E R
Sbjct: 313 FKTELCNKWEETGACPYGDQCQFAHGVAELR 343



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 12/19 (63%), Positives = 14/19 (73%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGD 253
           +KTELC  +EE G C YGD
Sbjct: 313 FKTELCNKWEETGACPYGD 331


>01_06_0049 - 25953811-25954131,25954223-25954903
          Length = 333

 Score = 69.3 bits (162), Expect = 3e-12
 Identities = 29/50 (58%), Positives = 34/50 (68%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           CQFAHGV ELR + RHP+YKT +CR   +   CPYG RCHF H+   A R
Sbjct: 279 CQFAHGVTELRPVIRHPRYKTAVCRMVLAGDVCPYGHRCHFRHSLTPAER 328



 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 15/31 (48%), Positives = 18/31 (58%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +KTELC  +   G CPYG +C F H   E R
Sbjct: 259 FKTELCNKWEETGDCPYGDQCQFAHGVTELR 289



 Score = 32.7 bits (71), Expect = 0.29
 Identities = 12/19 (63%), Positives = 14/19 (73%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGD 253
           +KTELC  +EE G C YGD
Sbjct: 259 FKTELCNKWEETGDCPYGD 277


>03_02_0709 + 10583621-10583626,10583711-10584712,10585304-10585669
          Length = 457

 Score = 65.7 bits (153), Expect = 3e-11
 Identities = 27/52 (51%), Positives = 35/52 (67%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           C+FAHG++ELR + RHP+YKT  C+ F +   CPYG RCHF H+   A   E
Sbjct: 402 CRFAHGLQELRPVIRHPRYKTLPCQMFAAASGCPYGHRCHFRHSPLRAAAAE 453



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 16/30 (53%), Positives = 18/30 (60%)
 Frame = +1

Query: 313 KTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           KTELC  +   G CPYG RC F H  +E R
Sbjct: 384 KTELCNKWER-GACPYGARCRFAHGLQELR 412


>08_01_0395 - 3502750-3503033,3504844-3505663
          Length = 367

 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = +1

Query: 292 LQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +Q+   +KT +C  +   G+CP+G +CHF H A E  +
Sbjct: 240 MQKPSNWKTRICNKWEMTGYCPFGSKCHFAHGAAELHK 277



 Score = 36.7 bits (81), Expect = 0.018
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +KT+LC  F + G CPY   C+F H  EE R+
Sbjct: 88  FKTKLCCKFRA-GTCPYVTNCNFAHGMEELRK 118



 Score = 34.7 bits (76), Expect = 0.071
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           YK   C+ F++   CPYG  C F+H+ E+++ RE
Sbjct: 170 YKGRHCKKFYTDEGCPYGDACTFLHD-EQSKARE 202


>08_02_1097 +
           24284494-24284496,24284946-24285407,24285476-24286450,
           24286566-24286655,24286760-24287021,24287447-24287472
          Length = 605

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 17/41 (41%), Positives = 25/41 (60%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHF 378
           C++AH   ELR +   PKY+TE CR + +   C YG +C +
Sbjct: 540 CEYAHSQDELRVIDARPKYRTEPCRYWLAGKGCWYGDKCRY 580



 Score = 29.5 bits (63), Expect = 2.7
 Identities = 12/44 (27%), Positives = 21/44 (47%)
 Frame = +1

Query: 271 GVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           G  + +  Q+  + KT +C  +   G C  G  C + H+ +E R
Sbjct: 507 GAIQAKGKQKMREPKTVMCPDWCRTGHCSSGDGCEYAHSQDELR 550


>07_01_0287 - 2094333-2094542,2094719-2095999
          Length = 496

 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 16/35 (45%), Positives = 21/35 (60%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           KYKT+LC+TF S G C +   C F H   E  ++E
Sbjct: 439 KYKTKLCKTFTSGGLCLFAANCRFAHGEVELGKKE 473



 Score = 29.9 bits (64), Expect = 2.0
 Identities = 22/54 (40%), Positives = 26/54 (48%), Gaps = 1/54 (1%)
 Frame = +1

Query: 229 SGGL*IWG*-CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHN 387
           SGGL ++   C+FAHG  EL         K E C  F S   CP G  C F H+
Sbjct: 450 SGGLCLFAANCRFAHGEVELG--------KKEPCWYFFSGQTCPRGDTCGFRHS 495


>06_03_0766 -
           24425486-24426245,24430766-24430855,24430951-24431070,
           24431568-24431746,24432046-24432231,24432454-24432547,
           24432679-24432743,24433652-24433987
          Length = 609

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +KT+LC  F+  G C +G RCHF H   E R+
Sbjct: 574 FKTKLCENFNK-GSCTFGDRCHFAHGESELRK 604



 Score = 33.1 bits (72), Expect = 0.22
 Identities = 10/28 (35%), Positives = 16/28 (57%)
 Frame = +1

Query: 313 KTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           KT +C  +++   C +G +CHF H   E
Sbjct: 414 KTRMCNKYNTAEGCKWGSKCHFAHGERE 441



 Score = 32.3 bits (70), Expect = 0.38
 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 5/33 (15%)
 Frame = +1

Query: 304 PKYKTELCRTFH-----SVGFCPYGPRCHFVHN 387
           PKYK    R FH     S   CP+G  CHF+HN
Sbjct: 343 PKYKP---RVFHRTSDGSTSGCPFGSSCHFLHN 372


>04_04_1500 +
           34010819-34011016,34013267-34013308,34014195-34014204,
           34014526-34014586,34014621-34014678,34015266-34015412,
           34015643-34016205,34018942-34019728
          Length = 621

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           YKT+LC  F   G C +G RCHF H   E R+
Sbjct: 588 YKTKLCENFVK-GTCTFGDRCHFAHGENEQRK 618



 Score = 33.1 bits (72), Expect = 0.22
 Identities = 10/28 (35%), Positives = 16/28 (57%)
 Frame = +1

Query: 313 KTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           KT +C  +++   C +G +CHF H   E
Sbjct: 417 KTRMCTKYNTAEGCKFGDKCHFAHGERE 444


>02_01_0703 + 5251901-5251950,5252783-5253554
          Length = 273

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +KT+LC  F + G C +G RCHF H   E R+
Sbjct: 239 FKTKLCENF-TKGSCTFGDRCHFAHGENELRK 269



 Score = 35.9 bits (79), Expect = 0.031
 Identities = 12/31 (38%), Positives = 17/31 (54%)
 Frame = +1

Query: 304 PKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           P  KT LC  +++   C +G +CHF H   E
Sbjct: 71  PTVKTRLCNKYNTAEGCKWGDKCHFAHGERE 101


>04_01_0021 +
           311914-312399,314218-314310,314391-314672,314754-314826,
           315273-315405,315476-315629,315763-315843,316174-316296,
           316629-316787,316862-316996,317159-317254,317416-317910,
           318651-318722,319496-319537
          Length = 807

 Score = 34.3 bits (75), Expect = 0.094
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 5/42 (11%)
 Frame = +1

Query: 298 RHPKYKTELCRTFH-----SVGFCPYGPRCHFVHNAEEARRR 408
           +HP +KT LC  F      S   C +G  C + H+ EE R R
Sbjct: 48  QHPMWKTSLCSFFRRRAASSADGCSHGDSCRYAHSEEELRPR 89


>01_01_0521 -
           3826257-3826616,3826758-3826918,3826992-3827049,
           3827426-3827497,3827582-3827639,3828231-3828347,
           3828630-3828782,3829182-3829346,3829814-3830132,
           3830276-3830780
          Length = 655

 Score = 34.3 bits (75), Expect = 0.094
 Identities = 14/31 (45%), Positives = 17/31 (54%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           YKT +C TF + G C +   C F H  EE R
Sbjct: 57  YKTRVCETFVTSGRCMFEDGCTFAHGDEELR 87


>07_03_0944 + 22787933-22789906
          Length = 657

 Score = 33.9 bits (74), Expect = 0.12
 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 2/53 (3%)
 Frame = +1

Query: 247 WG*CQFAHGVRELRNL--QRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEA 399
           W  C F H     R    ++HP Y    C  F   G CP G  C F H   E+
Sbjct: 253 WTECPFVHPGENARRRDPRKHP-YTAVPCPNFRRPGGCPSGDSCEFSHGVFES 304



 Score = 29.1 bits (62), Expect = 3.5
 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 1/64 (1%)
 Frame = +1

Query: 214 PTV*RSGGL*IWG*CQFAHGVRELRNLQRHP-KYKTELCRTFHSVGFCPYGPRCHFVHNA 390
           P   R GG      C+F+HGV E      HP +Y+T LC+     G       C F H+ 
Sbjct: 281 PNFRRPGGCPSGDSCEFSHGVFE---SWLHPSQYRTRLCKE----GAACARRICFFAHDE 333

Query: 391 EEAR 402
           +E R
Sbjct: 334 DELR 337


>02_02_0568 + 11577804-11578676,11578956-11579042,11579043-11579141
          Length = 352

 Score = 33.9 bits (74), Expect = 0.12
 Identities = 9/26 (34%), Positives = 17/26 (65%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHN 387
           Y+ ++C+ +   G+C YG  C F+H+
Sbjct: 188 YQPDICKDYKETGYCGYGDSCKFMHD 213



 Score = 31.1 bits (67), Expect = 0.88
 Identities = 9/30 (30%), Positives = 18/30 (60%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C YGD+   +    +Y
Sbjct: 188 YQPDICKDYKETGYCGYGDSCKFMHDRGDY 217


>09_03_0048 +
           11880848-11880952,11881030-11881312,11882667-11882770,
           11883998-11884416,11884698-11884998,11885136-11885232,
           11885719-11885864,11885975-11886103
          Length = 527

 Score = 31.9 bits (69), Expect = 0.50
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)
 Frame = +1

Query: 295 QRHPKYK-TELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           QRH +     LC  F S G CP G +C++ H+ EEAR
Sbjct: 227 QRHGEAGGNRLCFKFTSSGSCPRGSKCNYRHD-EEAR 262



 Score = 28.7 bits (61), Expect = 4.7
 Identities = 10/29 (34%), Positives = 14/29 (48%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y   +C  F + G C  GP C F H+  +
Sbjct: 265 YNRNVCFDFLNKGKCEKGPECRFAHSLSD 293


>10_07_0063 -
           12502305-12503361,12503567-12503668,12504251-12504378,
           12504653-12504764,12504876-12504927,12505260-12505517,
           12505943-12506079,12506296-12506606
          Length = 718

 Score = 31.5 bits (68), Expect = 0.67
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 286 RNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHN 387
           +N QR   +K   C  +   G+CPYG  C F+H+
Sbjct: 685 QNPQRFRPWKP--CFIYQQQGWCPYGENCKFMHD 716


>02_04_0624 +
           24538095-24538183,24538429-24538612,24538725-24538886,
           24538988-24539225,24539301-24539370,24539439-24539530,
           24539799-24539836,24540018-24540039,24540462-24540618,
           24540702-24540753,24542144-24542207,24542279-24542362,
           24543418-24543543,24543622-24543818,24543903-24544091,
           24544186-24544434,24544507-24544556,24544977-24545059,
           24545164-24545449,24545751-24545794,24545878-24546626
          Length = 1074

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 24/109 (22%), Positives = 48/109 (44%), Gaps = 2/109 (1%)
 Frame = +3

Query: 174 LRHQPQVATRPSSADRLKKRGFVN-MGIMPICSRRPRTTQSSASS*IQDGAVSHFPFGWL 350
           L + P+ A   +   R+K    +  M I P+ + R     ++  + I+D     F F W+
Sbjct: 176 LLNDPRGAALEAIVSRIKMLSRLGTMKIAPLANVRFIAVSATIPN-IEDIDYLRFGFAWI 234

Query: 351 LSLWTALPFRA*RRGSKTQRTI-VARRFIGIALIGRIYGVVYERRVAIA 494
            + W A+P    +R  +  R + +  +  G+ L+      ++ +R A A
Sbjct: 235 SAEWLAVPSEGIKRFGEEMRPVKLTTKVFGMVLVSHHIANIWPKRYAPA 283


>08_01_0824 - 8000829-8001272
          Length = 147

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 1/54 (1%)
 Frame = -3

Query: 594 DRGSSCGEKRKLWPVLVATSQVESEASMEMRRAW-RSRPVAHIRRHRSAR*ERC 436
           +R  S   +R+LW    A  + E   + + RR+W R R     RR RS R  RC
Sbjct: 94  ERRHSWRRRRRLWRRGGARGRAEVVVAGKRRRSWRRRRSRTRQRRRRSRRRRRC 147


>06_03_1309 +
           29223197-29223240,29223358-29223592,29223695-29223783,
           29223870-29223968,29224065-29224158,29224297-29224514,
           29224861-29224967,29225298-29225472,29225596-29225743,
           29226548-29226596,29228016-29228162,29229990-29229996,
           29230417-29230482,29230773-29231991,29232073-29233149,
           29233226-29233355,29233519-29233617,29233817-29233878,
           29234429-29234533
          Length = 1389

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 10/33 (30%), Positives = 20/33 (60%)
 Frame = +1

Query: 313 KTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           + E+CR F   G C YG +C ++H +   ++++
Sbjct: 4   RQEICRNFQR-GSCKYGAQCRYLHASPHQQQQQ 35


>05_01_0212 + 1601861-1603600
          Length = 579

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 16/51 (31%), Positives = 17/51 (33%), Gaps = 1/51 (1%)
 Frame = +1

Query: 247 WG*CQFAH-GVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           W  C F H G    R   R   Y    C  F   G C  G  C + H   E
Sbjct: 209 WTECPFVHPGENARRRDPRRYSYSCVPCPEFRKGGSCRKGDACEYAHGVFE 259


>11_01_0676 - 5511755-5511831,5512857-5513052,5513462-5513577,
            5513752-5514597,5515515-5515766,5522344-5525206
          Length = 1449

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 19/54 (35%), Positives = 28/54 (51%)
 Frame = +3

Query: 456  IYGVVYERRVAIATLAAFPLTPHSPPAMSPPAQATAFAFRRTNSPDPEDDRLPV 617
            I+ +VY  R  +   AA P  P  PPA +PP ++   A R + +P   +DR  V
Sbjct: 1035 IFELVYPIRAGLLEDAA-PRLPTPPPA-TPPQKSPVEALRSSAAPRRAEDRREV 1086


>07_03_1620 - 28180020-28180862
          Length = 280

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 2/51 (3%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHP-KYKTELCRTFHSVGF-CPYGPRCHFVHNAEEAR 402
           C++AHGV E   L  HP +++T +C    S G  CP    C F H+A E R
Sbjct: 116 CRYAHGVFE---LWLHPSRFRTRMC----SAGTRCP-RRICFFAHSAAELR 158


>06_01_1176 + 10112257-10113126
          Length = 289

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 20/48 (41%), Positives = 22/48 (45%), Gaps = 6/48 (12%)
 Frame = +3

Query: 495 TLAAFPLTPHSPPAMSPPA------QATAFAFRRTNSPDPEDDRLPVF 620
           TL+A    P S  A+SPP       QATAFA      P P    LP F
Sbjct: 140 TLSAAVSQPSSVDALSPPPAPMFADQATAFASLFAPPPPPPSQALPAF 187


>03_06_0186 - 32197461-32197751,32204940-32205548,32205603-32207009
          Length = 768

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +3

Query: 141 AVSNAPPVNRLLRHQPQVATRPSSADRLKKRGFVNMGIMPICSRRPRT 284
           A+  +PP   LL  +P    R  ++DRL  +G+ N G  P+C R   T
Sbjct: 656 AIIASPPRLTLLCLRP--VNRVWTSDRLATKGWQNNGRCPLCRREDET 701


>03_05_0918 - 28785233-28786613,28786894-28787140,28787773-28788238
          Length = 697

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 14/35 (40%), Positives = 18/35 (51%)
 Frame = +3

Query: 486 AIATLAAFPLTPHSPPAMSPPAQATAFAFRRTNSP 590
           A+  LA++P  P  PP   PPA+A A    R   P
Sbjct: 6   ALERLASWPTPPPPPPPPPPPAKAAAAEAERPCPP 40


>01_01_1089 - 8560008-8560220,8560456-8560977,8561095-8561283,
            8561377-8561642,8561967-8562111,8562411-8562530,
            8562611-8562930,8564161-8564341,8564434-8564580,
            8565186-8565497,8566303-8566450,8566592-8566765,
            8567385-8567446,8567499-8567571,8567628-8567683,
            8568370-8568645,8569541-8569588,8569870-8569991,
            8570258-8570413,8571037-8571079,8572624-8572701,
            8572972-8573070,8573168-8573209,8573302-8573304
          Length = 1264

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 15/42 (35%), Positives = 20/42 (47%)
 Frame = +1

Query: 277  RELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
            REL +    P  + E+C  F   G C  G  CHF H++   R
Sbjct: 970  RELVHGYVQPALENEMC-VFFLNGSCNRGDTCHFSHSSRAPR 1010


>12_02_1133 -
           26368323-26369457,26369556-26369635,26370145-26370201,
           26370508-26370601,26371006-26371092,26371179-26371268,
           26371396-26371649
          Length = 598

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 20/60 (33%), Positives = 27/60 (45%)
 Frame = +2

Query: 482 GRDRHARRISIDASLSTCDVATSTGHSFRFSPHELPRSGRRPTARF*PTFHRLSAISFIA 661
           G+ +H + + I   L+ CD       SF  S HE+   G  P  R   T HR  AI  +A
Sbjct: 346 GKTKHFQTLIISEELTLCDCPGLVFPSFSSSRHEMVSCGVLPIDRM--TKHR-EAIQVVA 402


>10_05_0067 + 8756044-8756075,8756180-8756357,8756800-8757471
          Length = 293

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = +3

Query: 210 SADRLKKRGFVNMGIMPICSRRPRTTQSSA 299
           + DRL+KRG+ N  + P+C    R TQ SA
Sbjct: 250 TVDRLQKRGWQNQQLCPLC----RVTQESA 275


>09_03_0031 +
           11735431-11735728,11736704-11737041,11737150-11737285,
           11737477-11737613,11737701-11737824,11738859-11739364
          Length = 512

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = -2

Query: 631 KSRLKTGSRSSSGSGEFVRRKAKAVACAGG 542
           +SR ++GSRS SGSG   RR  +  +  GG
Sbjct: 30  RSRSRSGSRSGSGSGSSRRRLPRKGSGGGG 59


>06_03_1121 +
           27767707-27768065,27768612-27769034,27770013-27770175,
           27770271-27770381,27770895-27770963,27771117-27771203,
           27771967-27772752
          Length = 665

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 14/46 (30%), Positives = 20/46 (43%), Gaps = 3/46 (6%)
 Frame = +1

Query: 256 CQFAHGVRELRN---LQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           C+F     E R      +H     + C  +  +GFCP GP C + H
Sbjct: 92  CRFFRDFGECREPDCAYKHSYDDVKECNMY-KMGFCPNGPNCRYKH 136


>01_06_1805 -
           39999987-40000169,40000648-40000974,40001724-40002017,
           40002112-40002231,40002714-40002776,40003150-40003310,
           40003864-40004035
          Length = 439

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 10/25 (40%), Positives = 14/25 (56%)
 Frame = +1

Query: 325 CRTFHSVGFCPYGPRCHFVHNAEEA 399
           C+ +   G C +GP C F H  E+A
Sbjct: 131 CQYYLKTGTCKFGPTCKFHHPREKA 155



 Score = 27.9 bits (59), Expect = 8.2
 Identities = 9/22 (40%), Positives = 12/22 (54%)
 Frame = +1

Query: 319 ELCRTFHSVGFCPYGPRCHFVH 384
           ELC+ +   G C +G  C F H
Sbjct: 382 ELCKFYSRYGICKFGANCKFDH 403


>06_03_0512 + 21633594-21633890
          Length = 98

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 15/39 (38%), Positives = 19/39 (48%)
 Frame = -1

Query: 482 PSLIYDAIDPPDESDANEPPGDDGSLRLASSALCTKWQR 366
           PS+ Y  + PP   DA EPP     +R  S A    W+R
Sbjct: 55  PSITYRMMPPP-LPDALEPPTTTTMMRRTSRATAMVWER 92


>04_04_0372 + 24781572-24781612,24781696-24782413
          Length = 252

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 14/33 (42%), Positives = 17/33 (51%)
 Frame = +3

Query: 522 HSPPAMSPPAQATAFAFRRTNSPDPEDDRLPVF 620
           +S P ++PP  A   A  RT  P  E  R PVF
Sbjct: 133 NSNPLVAPPPAAEQRALMRTPGPGGESARRPVF 165


>03_05_0865 - 28365430-28367640
          Length = 736

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 2/59 (3%)
 Frame = +3

Query: 438 IALIGRIYGVVYERRVAIATLAAFPLT--PHSPPAMSPPAQATAFAFRRTNSPDPEDDR 608
           +AL  R   V  +RR A+  L + P    P  PP  +PP  +++   R ++  D + DR
Sbjct: 22  LALERRQAAVTDQRRSALDLLQSLPRPPPPPPPPLSNPPRDSSSSHHRDSSDRDRDRDR 80


>01_04_0146 - 16711102-16711288,16712038-16712760,16712848-16712888
          Length = 316

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 14/33 (42%), Positives = 17/33 (51%)
 Frame = +3

Query: 522 HSPPAMSPPAQATAFAFRRTNSPDPEDDRLPVF 620
           +S P ++PP  A   A  RT  P  E  R PVF
Sbjct: 145 NSNPLVAPPPAAEQRALMRTPGPGGESARRPVF 177


>06_03_0867 + 25534760-25539620,25540662-25540857,25540957-25541104,
            25541673-25541751,25542151-25542238,25542330-25542600,
            25542676-25542718,25542801-25542904,25543374-25543790
          Length = 2068

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 11/36 (30%), Positives = 18/36 (50%)
 Frame = +1

Query: 301  HPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRR 408
            H K+ + +C  F + G CP G RC   H   + + +
Sbjct: 1932 HKKH-SYVCPVFEATGECPQGSRCKLHHPKSKVKSK 1966


>05_06_0141 - 25964706-25965473
          Length = 255

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 3/53 (5%)
 Frame = +1

Query: 247 WG*CQFAH-GVRELRNLQRHPKYKTELCRTFHSV--GFCPYGPRCHFVHNAEE 396
           W  C +AH G    R   R   Y  E C  F       CP G  C F H   E
Sbjct: 77  WTACPYAHPGEAARRRDPRRVAYTGEPCPDFRRRPGAACPRGSTCPFAHGTFE 129


>05_04_0306 +
           20058640-20059159,20060406-20060819,20060921-20061190,
           20062179-20062849
          Length = 624

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 1/44 (2%)
 Frame = +3

Query: 453 RIYGVVYERRVAIATLAAFPLT-PHSPPAMSPPAQATAFAFRRT 581
           R + +     VA+A  A+ P T P  PP+ + P   T    RRT
Sbjct: 100 RCHSMASHAHVALALSASRPATRPPQPPSFAAPPLPTPITMRRT 143


>05_03_0474 +
           14481063-14481403,14481597-14481710,14483428-14483676,
           14485844-14486225
          Length = 361

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 1/29 (3%)
 Frame = +3

Query: 513 LTPHSPPAMSPPAQ-ATAFAFRRTNSPDP 596
           L+  SPP  SP  + ATAFA R  + PDP
Sbjct: 15  LSSSSPPPPSPGRRTATAFAVRPRSLPDP 43


>03_05_0618 + 26177743-26178420,26179477-26179617
          Length = 272

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 15/40 (37%), Positives = 22/40 (55%)
 Frame = -2

Query: 658 DERDRREPMKSRLKTGSRSSSGSGEFVRRKAKAVACAGGD 539
           DE    E  +S++  GS+ SSGS +  +RK  +   A GD
Sbjct: 232 DEAGADEEDESKVANGSKGSSGSAQPNKRKRDSEDDANGD 271


>01_05_0024 -
           17262504-17263308,17264251-17264399,17264879-17264978,
           17265829-17265953,17267565-17267743,17269648-17270698
          Length = 802

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = +3

Query: 474 ERRVAIATLAAFPLTPHSPPAMSPPAQATAFAFRRTNSPDP 596
           ++RV + ++ + P+TP  PP  +P   AT     RT  P P
Sbjct: 189 QKRVMMGSVGSSPVTPPPPPRPNPSPPAT-----RTTPPPP 224


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,474,723
Number of Sequences: 37544
Number of extensions: 416723
Number of successful extensions: 2043
Number of sequences better than 10.0: 40
Number of HSP's better than 10.0 without gapping: 1828
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2038
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1792053856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).