SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0004
         (598 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_02_0021 + 11307795-11308093,11308454-11308556,11309623-113099...    31   0.92 
09_06_0081 + 20745627-20748144,20748211-20748308                       30   1.6  
09_02_0082 - 4060018-4061604                                           29   2.1  
09_02_0080 - 4020020-4020047,4020160-4022044,4022079-4022817           29   2.1  
08_02_0386 - 16575636-16575698,16575799-16575858,16575947-165762...    29   3.7  
02_01_0075 - 522554-522616,522742-522748,523033-523136,523237-52...    28   4.9  
03_02_0458 + 8643804-8643904,8643994-8644091,8644206-8644504,864...    28   6.5  
07_03_0446 - 18285132-18285221,18285437-18285499,18285805-182858...    27   8.6  
03_02_0263 - 6948618-6948818,6948909-6948971,6949078-6949146,694...    27   8.6  
02_05_0300 + 27681204-27681656,27681745-27681840,27681933-276820...    27   8.6  

>08_02_0021 +
           11307795-11308093,11308454-11308556,11309623-11309931,
           11310190-11310618
          Length = 379

 Score = 30.7 bits (66), Expect = 0.92
 Identities = 16/47 (34%), Positives = 21/47 (44%)
 Frame = +1

Query: 205 SEEDWHKTRNSF*SIGTRSPXRGELYNGYXGREHRTSHPLEXAADRR 345
           S ++W   R SF     R   RG ++  Y GR+ R   P    A RR
Sbjct: 120 SMQEWSSERCSFVQEALRGSGRGHIWAFYRGRQRRLGPPPPLPARRR 166


>09_06_0081 + 20745627-20748144,20748211-20748308
          Length = 871

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 12/22 (54%), Positives = 12/22 (54%)
 Frame = +2

Query: 386 PRASAPPGPTPQRDYRPVPRTP 451
           PR  APP PTP     PVP  P
Sbjct: 344 PRTLAPPAPTPPAPATPVPMPP 365


>09_02_0082 - 4060018-4061604
          Length = 528

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +2

Query: 377 MXLPRASAPPGPTPQRDYRPVPRTPIL 457
           + +PRA APP P P     P+P  P L
Sbjct: 249 LRVPRAPAPPVPAPLAPTPPIPTPPAL 275


>09_02_0080 - 4020020-4020047,4020160-4022044,4022079-4022817
          Length = 883

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 12/25 (48%), Positives = 14/25 (56%)
 Frame = +2

Query: 383 LPRASAPPGPTPQRDYRPVPRTPIL 457
           +PRA APP P P     P+P  P L
Sbjct: 360 VPRAPAPPVPAPPAPTPPIPTPPAL 384



 Score = 28.3 bits (60), Expect = 4.9
 Identities = 11/24 (45%), Positives = 14/24 (58%)
 Frame = +2

Query: 383 LPRASAPPGPTPQRDYRPVPRTPI 454
           +P A APP PTP   +  VP  P+
Sbjct: 530 MPPAPAPPIPTPSMPFPTVPAPPV 553


>08_02_0386 -
           16575636-16575698,16575799-16575858,16575947-16576239,
           16576361-16576517,16576601-16576948,16577047-16577177,
           16577417-16577882,16578425-16579132
          Length = 741

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 11/22 (50%), Positives = 11/22 (50%)
 Frame = +2

Query: 386 PRASAPPGPTPQRDYRPVPRTP 451
           P   APP P   R  RP PR P
Sbjct: 39  PATEAPPAPKQHRGPRPAPRNP 60


>02_01_0075 -
           522554-522616,522742-522748,523033-523136,523237-523368,
           525209-525401,525978-526330,526693-526791,526864-526935,
           527062-527213,527338-527386,527755-527885,528067-528307,
           528392-528565,528656-528797,529236-529282,529370-529450,
           530170-530271,530345-530440,531437-531444,531575-531616,
           531830-531894,534761-534853,534888-534959,535303-535509,
           536318-537226,537503-538158
          Length = 1429

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 11/21 (52%), Positives = 13/21 (61%)
 Frame = +2

Query: 383 LPRASAPPGPTPQRDYRPVPR 445
           LPR+ APP P+P    R  PR
Sbjct: 25  LPRSRAPPSPSPSTSSRAKPR 45


>03_02_0458 +
           8643804-8643904,8643994-8644091,8644206-8644504,
           8645930-8646460
          Length = 342

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 10/19 (52%), Positives = 12/19 (63%)
 Frame = +2

Query: 386 PRASAPPGPTPQRDYRPVP 442
           P   APP P PQ+  +PVP
Sbjct: 12  PHPQAPPPPPPQQQQQPVP 30


>07_03_0446 -
           18285132-18285221,18285437-18285499,18285805-18285867,
           18286079-18286129,18286413-18286506,18286696-18286856,
           18287089-18287145,18287380-18287493,18287934-18287999,
           18288063-18288266,18289207-18289284,18289669-18289788,
           18290425-18290491,18290635-18290735,18290820-18290936,
           18292024-18292107,18292181-18292309,18292385-18292510,
           18292622-18292696,18292814-18292947,18293032-18293137,
           18293220-18293276,18294387-18294573,18295244-18295407,
           18296129-18296353,18296538-18296744,18297043-18297375,
           18297604-18297993
          Length = 1220

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 11/24 (45%), Positives = 13/24 (54%)
 Frame = +2

Query: 383 LPRASAPPGPTPQRDYRPVPRTPI 454
           LPR   PP P P +   P PR P+
Sbjct: 22  LPRKRPPPSPPPPQPPCPPPRRPL 45


>03_02_0263 -
           6948618-6948818,6948909-6948971,6949078-6949146,
           6949232-6949297,6949380-6949526,6949608-6949702,
           6949845-6950016,6952187-6952318,6953581-6953674,
           6954067-6954184,6955884-6957057
          Length = 776

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 13/34 (38%), Positives = 16/34 (47%)
 Frame = +2

Query: 350 LKYGDRVXTMXLPRASAPPGPTPQRDYRPVPRTP 451
           L  GD +     P  S  P P PQ   +P+PR P
Sbjct: 77  LASGDLLYFTLSPLPSPSPPPQPQPQAQPLPRNP 110


>02_05_0300 +
           27681204-27681656,27681745-27681840,27681933-27682022,
           27682126-27682227,27682310-27682456,27683608-27683748,
           27683749-27683808,27685133-27685230,27685308-27685410,
           27685954-27686037
          Length = 457

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 10/19 (52%), Positives = 13/19 (68%)
 Frame = -2

Query: 450 GVRGTGR*SRWGVGPGGAE 394
           G  G G  ++WG GPGGA+
Sbjct: 84  GAGGAGGPNKWGRGPGGAD 102


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,657,508
Number of Sequences: 37544
Number of extensions: 164016
Number of successful extensions: 723
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 639
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 719
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1423789920
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).