SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0002
         (598 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_06_1074 + 34318685-34319314,34319429-34319546,34319662-343198...    50   2e-06
04_04_0786 - 28052981-28053040,28053123-28053222,28053447-280535...    48   4e-06
05_05_0315 - 24030695-24030787,24030896-24030995,24031120-240312...    48   8e-06
02_05_1339 + 35793795-35794922,35795009-35795233,35795314-35795460     48   8e-06
03_06_0235 + 32539025-32539886,32540330-32540473,32540595-325407...    47   1e-05
11_01_0449 - 3473662-3475049,3476026-3476128,3476215-3476439,347...    46   2e-05
07_01_0437 - 3322132-3322251,3322345-3322569,3322953-3323120,332...    46   2e-05
05_07_0280 - 28920864-28920971,28921076-28921175,28921267-289213...    46   2e-05
12_01_0450 - 3552701-3552865,3552971-3553195,3553306-3553473,355...    46   2e-05
07_03_0588 - 19715677-19715754,19715843-19715942,19716170-197162...    46   2e-05
01_05_0743 + 24835349-24836009,24836925-24837068,24837154-248373...    46   2e-05
02_05_0340 + 28105222-28105960,28106844-28106987,28107083-281072...    45   4e-05
12_01_0217 + 1647319-1648327,1648462-1648577,1648650-1648817,164...    44   7e-05
11_01_0216 + 1693889-1694897,1695034-1695149,1695222-1695389,169...    44   7e-05
05_05_0154 - 22774503-22774652,22774738-22774968,22775508-227756...    39   0.003
02_04_0547 - 23786224-23786718                                         39   0.003
05_04_0127 - 18262499-18263104                                         39   0.003
01_05_0049 + 17577358-17577993                                         38   0.005
08_02_1430 - 27048055-27048408,27049674-27049841,27049927-270500...    38   0.008
02_05_0646 - 30598769-30599293                                         38   0.008
01_01_1223 + 9886709-9886784,9887566-9887935,9888028-9888097           37   0.011
07_03_0947 - 22805419-22805571,22805736-22805966,22806161-228063...    37   0.014
01_06_1236 + 35613123-35613816,35615809-35615952,35616032-356161...    37   0.014
01_06_1085 + 34414353-34414428,34416038-34416407,34416534-34416651     37   0.014
08_02_1589 + 28070286-28070525,28072224-28072565                       36   0.019
03_05_1090 + 30313176-30313292,30314162-30314236,30314938-303151...    36   0.019
07_03_1286 + 25482632-25482685,25483948-25484145,25484242-254844...    36   0.025
05_01_0448 + 3566151-3567380,3567877-3568188,3568318-3568455           36   0.025
01_07_0179 - 41814886-41815074,41815172-41815222,41815365-418154...    36   0.025
01_05_0628 - 23806901-23807650                                         36   0.032
05_01_0450 + 3577928-3579526,3579695-3579832                           35   0.057
07_03_1738 - 29141829-29141989,29142112-29142343,29142751-291427...    34   0.075
05_07_0229 - 28537784-28538296                                         34   0.075
05_05_0309 - 23987669-23988042,23989485-23989560                       34   0.075
03_02_0817 + 11492699-11492774,11493605-11493978                       34   0.075
02_01_0763 - 5665010-5665202,5665285-5665375,5665460-5666245,566...    34   0.075
01_01_1156 - 9194477-9194485,9194801-9195156,9197783-9197858           34   0.075
04_04_0419 + 25086456-25086768,25087302-25087369,25087458-250876...    34   0.099
12_01_0207 - 1559491-1559544,1559806-1560161,1560244-1560363,156...    33   0.13 
05_05_0298 - 23926266-23926442,23926573-23926632,23926822-239270...    33   0.13 
12_01_0398 - 3143745-3143777,3144045-3144126,3144863-3144975,314...    33   0.23 
11_06_0212 - 21319441-21319498,21319737-21319867,21319944-213200...    33   0.23 
11_01_0203 - 1610086-1610192,1610620-1610669,1610888-1611348           32   0.30 
06_03_1213 - 28463774-28464286                                         32   0.30 
06_03_0691 + 23552437-23552914,23555168-23555953,23556045-235561...    32   0.30 
05_01_0445 + 3547176-3547577,3548625-3549557,3550246-3550524,355...    32   0.30 
04_04_0351 + 24615858-24616448                                         32   0.30 
01_07_0217 + 42072475-42072915                                         32   0.30 
12_02_0370 + 18139557-18140469,18140561-18140704,18140804-181409...    32   0.40 
06_03_0724 - 23890715-23890929,23891311-23891506                       32   0.40 
03_06_0394 + 33592780-33593310,33593890-33594013,33594233-335943...    32   0.40 
12_02_1027 + 25496311-25496811                                         31   0.53 
08_02_1569 - 27924930-27925034,27925149-27925167,27925271-279254...    31   0.53 
03_05_0739 + 27271404-27271988,27272265-27272411                       31   0.53 
07_03_0043 - 12741661-12741816,12741980-12742153,12742870-127429...    31   0.70 
02_04_0593 + 24177897-24178182,24178442-24178509,24178617-241788...    31   0.70 
01_07_0216 - 42071041-42071496                                         31   0.70 
09_02_0362 + 7860088-7860197,7861606-7861636,7861738-7861801,786...    30   1.2  
04_04_0934 + 29504806-29505532,29506059-29506202,29506291-295064...    30   1.2  
04_04_0433 + 25163111-25163471,25163943-25164154,25164420-251647...    30   1.2  
01_05_0422 - 22018579-22018698,22019548-22019644,22019744-220199...    30   1.2  
05_03_0020 - 7433619-7434089                                           29   2.1  
02_01_0738 + 5501894-5501978,5502130-5502369,5502880-5503079,550...    29   2.1  
01_07_0252 - 42296138-42296281,42296527-42296613,42297043-422971...    29   2.1  
01_07_0215 - 42066753-42067208                                         29   2.1  
12_01_0249 + 1850443-1851030                                           29   2.8  
11_01_0250 + 1924261-1924848                                           29   2.8  
10_08_0427 + 17828007-17828570,17829788-17829904,17830319-178303...    29   2.8  
12_01_0771 - 7013343-7013861                                           29   3.7  
11_01_0656 - 5301048-5301441,5301779-5301976,5302056-5302228,530...    29   3.7  
09_04_0720 - 19720844-19720975,19721582-19721809,19722108-197222...    29   3.7  
09_04_0555 + 18498442-18498864                                         28   4.9  
01_07_0178 + 41810795-41811409                                         28   4.9  
09_04_0557 + 18503380-18503793                                         28   6.5  
01_05_0457 + 22423998-22424039,22424139-22424415,22424540-224246...    28   6.5  
11_01_0270 + 2037053-2037108,2037294-2037408                           27   8.6  
09_04_0553 + 18493865-18494281                                         27   8.6  
06_01_0982 + 7627420-7628141,7628190-7628643,7629167-7629823,762...    27   8.6  
03_06_0239 - 32578231-32578353,32578431-32578655,32579081-325792...    27   8.6  
01_06_1718 - 39408179-39408427,39409102-39409217,39409460-394096...    27   8.6  

>01_06_1074 +
           34318685-34319314,34319429-34319546,34319662-34319814,
           34319906-34320021,34320135-34320302,34320424-34320551,
           34320645-34320744,34320866-34320958
          Length = 501

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 24/69 (34%), Positives = 38/69 (55%)
 Frame = +3

Query: 264 CLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSS 443
           CLS     I GL  +F+ MD D S  +  +E   G+ + G +L ++E ++L    D D +
Sbjct: 344 CLSE--EEIRGLKEMFKSMDSDNSGTITVDELRKGLSKQGTKLTEAEVQQLMEAADADGN 401

Query: 444 GSISLDEFL 470
           G+I  DEF+
Sbjct: 402 GTIDYDEFI 410


>04_04_0786 -
           28052981-28053040,28053123-28053222,28053447-28053574,
           28053654-28053821,28053901-28054013,28054135-28054287,
           28054385-28054528,28054794-28055529
          Length = 533

 Score = 48.4 bits (110), Expect = 4e-06
 Identities = 23/61 (37%), Positives = 34/61 (55%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           I GL ++F  MD D S  +  EE   G+ + G  ++++E ++L    D D SGSI   EF
Sbjct: 393 IKGLKQMFNNMDTDRSGTITVEELKVGLTKLGSRISEAEVQKLMEAVDVDKSGSIDYSEF 452

Query: 468 L 470
           L
Sbjct: 453 L 453


>05_05_0315 -
           24030695-24030787,24030896-24030995,24031120-24031247,
           24031350-24031517,24031626-24031741,24031773-24031896,
           24032085-24032254,24032255-24032999
          Length = 547

 Score = 47.6 bits (108), Expect = 8e-06
 Identities = 23/69 (33%), Positives = 38/69 (55%)
 Frame = +3

Query: 264 CLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSS 443
           CLS     I GL  +F+ MD D S  +  +E   G+ + G +L ++E ++L    D D +
Sbjct: 390 CLSE--EEIRGLKEMFKSMDSDNSGTITVDELRKGLAKKGTKLTEAEVQQLMEAADADGN 447

Query: 444 GSISLDEFL 470
           G+I  +EF+
Sbjct: 448 GTIDYEEFI 456



 Score = 37.1 bits (82), Expect = 0.011
 Identities = 20/67 (29%), Positives = 35/67 (52%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F+  D D S  +  EE    ++E GL ++  E +++ S+ D D+ G I+  EF+  +R  
Sbjct: 475 FQYFDKDNSGYITIEELEQALREKGL-MDGREIKDIISEVDADNDGRINYTEFVAMMRKG 533

Query: 489 MSESRRK 509
             E+  K
Sbjct: 534 DPEANPK 540


>02_05_1339 + 35793795-35794922,35795009-35795233,35795314-35795460
          Length = 499

 Score = 47.6 bits (108), Expect = 8e-06
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           R++  +     + GL  +F+ MD D S  +  +E   G++  G  L ++E  +L    D 
Sbjct: 320 RVIARNLSEEELAGLKEMFKAMDTDASGAITFDELKEGLRRYGSNLREAEIRDLMDAADV 379

Query: 435 DSSGSISLDEFL 470
           D SG+I  DEF+
Sbjct: 380 DKSGTIDYDEFI 391



 Score = 29.1 bits (62), Expect = 2.8
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 4/52 (7%)
 Frame = +3

Query: 321 DDDGSKLLNKEEFLYGIKETGLELNKSEAEE----LFSQFDTDSSGSISLDE 464
           D D S  ++ +EF+       + LNK E EE     F+ FD D SG I++DE
Sbjct: 378 DVDKSGTIDYDEFIAAT----VHLNKLEREEHLLAAFAYFDRDGSGYITVDE 425


>03_06_0235 +
           32539025-32539886,32540330-32540473,32540595-32540747,
           32540871-32540986,32541254-32541421,32541534-32541758,
           32541884-32542015
          Length = 599

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 24/72 (33%), Positives = 37/72 (51%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           R++  +     I GL  +F+ +D D S  +  EE   G+K+ G  L +SE   L    D 
Sbjct: 425 RVIAENLSEDEIAGLKEMFKMIDTDNSGQITFEELKVGLKKVGANLQESEIYALMQAADV 484

Query: 435 DSSGSISLDEFL 470
           D+SG+I   EF+
Sbjct: 485 DNSGTIDYGEFI 496



 Score = 35.1 bits (77), Expect = 0.043
 Identities = 18/60 (30%), Positives = 30/60 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F+  D DGS  +  +E     +E GL     + EE+  + D D+ G I  +EF+  ++ P
Sbjct: 515 FQYFDKDGSGYITADELQLACEEFGL--GDVQLEEMIREVDEDNDGRIDYNEFVAMMQKP 572


>11_01_0449 -
           3473662-3475049,3476026-3476128,3476215-3476439,
           3476689-3476856,3477414-3477529,3477640-3477792,
           3477879-3478022,3478980-3479583
          Length = 966

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 24/72 (33%), Positives = 37/72 (51%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           R++  S     I GL  +F+ +D D S  +  +E   G+K  G EL + E + L    D 
Sbjct: 339 RVIAESLSEEEIGGLKELFKMIDTDDSGTITFDELKEGLKRVGSELTEHEIQALMEAADI 398

Query: 435 DSSGSISLDEFL 470
           D+SG+I   EF+
Sbjct: 399 DNSGTIDYGEFI 410



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 4/52 (7%)
 Frame = +3

Query: 321 DDDGSKLLNKEEFLYGIKETGLELNKSEAEE----LFSQFDTDSSGSISLDE 464
           D D S  ++  EF+       L +NK E EE     FS FD D SG I++DE
Sbjct: 397 DIDNSGTIDYGEFIAAT----LHMNKLEREENLVSAFSFFDKDGSGFITIDE 444


>07_01_0437 -
           3322132-3322251,3322345-3322569,3322953-3323120,
           3323207-3323322,3323394-3323546,3323655-3323798,
           3324475-3325255
          Length = 568

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 24/72 (33%), Positives = 35/72 (48%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           R++  +     I GL  +F+ +D D S  +  EE   G++  G  L  SE   L    D 
Sbjct: 398 RVIAENLSEDEIAGLREMFKMLDTDNSGQITLEELKTGLRRVGANLKDSEITTLMEAADI 457

Query: 435 DSSGSISLDEFL 470
           D+SGSI   EF+
Sbjct: 458 DNSGSIDYGEFI 469



 Score = 27.9 bits (59), Expect = 6.5
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = +3

Query: 411 ELFSQFDTDSSGSISLDEFLIKIR 482
           E+F   DTD+SG I+L+E    +R
Sbjct: 414 EMFKMLDTDNSGQITLEELKTGLR 437


>05_07_0280 -
           28920864-28920971,28921076-28921175,28921267-28921394,
           28922013-28922180,28922280-28922395,28922584-28922736,
           28922904-28923047,28923401-28924133
          Length = 549

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 21/61 (34%), Positives = 35/61 (57%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           I+GL  +F+ +D D S  +  EE   G+ + G ++++SE  +L    D D +GSI   EF
Sbjct: 393 IVGLKEMFKSLDTDNSGTITLEELRAGLPKLGTKISESELRQLMEAADVDGNGSIDYVEF 452

Query: 468 L 470
           +
Sbjct: 453 I 453



 Score = 27.5 bits (58), Expect = 8.6
 Identities = 15/56 (26%), Positives = 25/56 (44%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           L ++    D DG+  ++  EF+           +    + F  FD D SG I++DE
Sbjct: 432 LRQLMEAADVDGNGSIDYVEFISATMHMNRLEKEDHIYKAFEYFDKDHSGFITVDE 487


>12_01_0450 -
           3552701-3552865,3552971-3553195,3553306-3553473,
           3554514-3554629,3554735-3554887,3554978-3555121,
           3556667-3557276
          Length = 526

 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 24/72 (33%), Positives = 37/72 (51%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           R++  S     I GL  +F+ +D D S  +  +E   G+K  G +L + E + L    D 
Sbjct: 341 RVIAESLSEEEIGGLKELFKMIDTDNSGTITYDELKNGLKRVGSDLMEPEIQALMDAADI 400

Query: 435 DSSGSISLDEFL 470
           D+SG+I   EFL
Sbjct: 401 DNSGTIDYGEFL 412



 Score = 29.1 bits (62), Expect = 2.8
 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 4/52 (7%)
 Frame = +3

Query: 321 DDDGSKLLNKEEFLYGIKETGLELNKSEAEE----LFSQFDTDSSGSISLDE 464
           D D S  ++  EFL       L +NK E EE     F+ FD D SG I++DE
Sbjct: 399 DIDNSGTIDYGEFLAAT----LHMNKLEREENLVSAFTFFDKDGSGFITIDE 446


>07_03_0588 -
           19715677-19715754,19715843-19715942,19716170-19716297,
           19716385-19716552,19716623-19716735,19716820-19716972,
           19717082-19717225,19718710-19719427
          Length = 533

 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 22/61 (36%), Positives = 35/61 (57%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           I GL ++F  MD D S  +  EE   G+ + G +L+++E ++L    D D +GSI   EF
Sbjct: 387 IKGLKQMFTNMDTDNSGTITYEELKAGLAKLGSKLSEAEVKQLMEAADVDGNGSIDYVEF 446

Query: 468 L 470
           +
Sbjct: 447 I 447



 Score = 32.3 bits (70), Expect = 0.30
 Identities = 17/62 (27%), Positives = 33/62 (53%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           L + F+  D D S  + ++E    + E  +  + S  +++ S+ DTD+ G I+ +EF   
Sbjct: 462 LFKAFQYFDKDNSGFITRDELESALIEHEMG-DTSTIKDIISEVDTDNDGRINYEEFCAM 520

Query: 477 IR 482
           +R
Sbjct: 521 MR 522


>01_05_0743 +
           24835349-24836009,24836925-24837068,24837154-24837306,
           24837627-24837742,24837826-24837993,24838610-24838737,
           24838827-24838926,24839119-24839205
          Length = 518

 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 21/61 (34%), Positives = 34/61 (55%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           I GL  +FR +D D S  +  EE   G+ + G ++++SE  +L    D D +G+I   EF
Sbjct: 369 ITGLKEMFRSLDTDNSGTITLEELRSGLPKLGTKISESEIRQLMEAADVDGNGTIDYAEF 428

Query: 468 L 470
           +
Sbjct: 429 I 429



 Score = 32.7 bits (71), Expect = 0.23
 Identities = 19/73 (26%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           + F   D D S  +  +E    +K+  +  +K+  +E+ ++ DTD  G I+  EF+  +R
Sbjct: 446 KAFEYFDKDHSGYITVDELEEALKKYDMGDDKT-IKEIIAEVDTDHDGRINYQEFVAMMR 504

Query: 483 ---PPMSESRRKL 512
              P ++ +RR++
Sbjct: 505 NNNPEIAPNRRRM 517


>02_05_0340 +
           28105222-28105960,28106844-28106987,28107083-28107235,
           28107418-28107533,28107819-28107986,28108792-28109016,
           28110445-28110483,28110497-28110592
          Length = 559

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 23/72 (31%), Positives = 37/72 (51%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           R++  S     I GL  +F+ MD D S  +  +E   G+++ G  L  +E  +L    D 
Sbjct: 384 RVIAESLSEEEIAGLKEMFKAMDTDNSGAITYDELKEGMRKYGSTLKDTEIRDLMEAADV 443

Query: 435 DSSGSISLDEFL 470
           D+SG+I   EF+
Sbjct: 444 DNSGTIDYIEFI 455



 Score = 30.3 bits (65), Expect = 1.2
 Identities = 22/52 (42%), Positives = 27/52 (51%), Gaps = 4/52 (7%)
 Frame = +3

Query: 321 DDDGSKLLNKEEFLYGIKETGLELNKSEAEE----LFSQFDTDSSGSISLDE 464
           D D S  ++  EF+       L LNK E EE     FS FD D SG I++DE
Sbjct: 442 DVDNSGTIDYIEFIAAT----LHLNKLEREEHLVAAFSYFDKDGSGYITVDE 489



 Score = 27.5 bits (58), Expect = 8.6
 Identities = 15/39 (38%), Positives = 23/39 (58%)
 Frame = +3

Query: 348 KEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           K+  L  I E+  E   +  +E+F   DTD+SG+I+ DE
Sbjct: 379 KKMALRVIAESLSEEEIAGLKEMFKAMDTDNSGAITYDE 417


>12_01_0217 +
           1647319-1648327,1648462-1648577,1648650-1648817,
           1648911-1649038,1649121-1649220,1649329-1649433
          Length = 541

 Score = 44.4 bits (100), Expect = 7e-05
 Identities = 23/69 (33%), Positives = 36/69 (52%)
 Frame = +3

Query: 264 CLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSS 443
           CLS     I GL  +F+ +D D S  +  EE   G+ + G + + +E E+L    D D +
Sbjct: 380 CLSE--EEIKGLKEMFKNIDKDNSGTITLEELKNGLAKQGTKFSDNEIEQLMEAADADGN 437

Query: 444 GSISLDEFL 470
           G I  +EF+
Sbjct: 438 GIIDYEEFV 446



 Score = 36.3 bits (80), Expect = 0.019
 Identities = 18/58 (31%), Positives = 32/58 (55%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           F+  D D S  + KEE    +KE GL  + +E +++ +  D+++ G I   EF+  +R
Sbjct: 465 FQYFDKDNSGYITKEELEQALKEQGL-YDANEIKDVITDADSNNDGRIDYSEFVAMMR 521


>11_01_0216 +
           1693889-1694897,1695034-1695149,1695222-1695389,
           1695482-1695609,1695692-1695791,1696124-1696168
          Length = 521

 Score = 44.4 bits (100), Expect = 7e-05
 Identities = 23/69 (33%), Positives = 36/69 (52%)
 Frame = +3

Query: 264 CLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSS 443
           CLS     I GL  +F+ +D D S  +  EE   G+ + G + + +E E+L    D D +
Sbjct: 380 CLSE--EEIKGLKEMFKNIDKDNSGTITLEELKNGLAKQGTKFSDNEIEQLMEAADADGN 437

Query: 444 GSISLDEFL 470
           G I  +EF+
Sbjct: 438 GIIDYEEFV 446



 Score = 28.3 bits (60), Expect = 4.9
 Identities = 14/46 (30%), Positives = 26/46 (56%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSG 446
           F+  D D S  + KEE    +KE GL  + +E +++ +  D+++ G
Sbjct: 465 FQYFDKDNSGYITKEELEQALKEQGL-YDANEIKDVITDADSNNVG 509


>05_05_0154 -
           22774503-22774652,22774738-22774968,22775508-22775675,
           22775760-22775936,22776281-22776302,22776351-22776417,
           22776583-22776774,22776819-22776962,22778421-22779102
          Length = 610

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 19/55 (34%), Positives = 30/55 (54%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +F+ MD D   +++ EE   GI + G  L +SE + L    DT+  G++   EFL
Sbjct: 445 MFKVMDTDNDGIVSYEELKSGIAKFGSHLAESEVQMLIEAVDTNGRGALDYGEFL 499



 Score = 36.3 bits (80), Expect = 0.019
 Identities = 23/74 (31%), Positives = 35/74 (47%)
 Frame = +3

Query: 261 LCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDS 440
           L L R A+G   L R F   D DG+  +  EE    + E G        +++  + DTD 
Sbjct: 503 LHLQRMANGE-HLRRAFLFFDKDGNGYIEPEELQEALVEDGATDIMEVVKDILQEVDTDK 561

Query: 441 SGSISLDEFLIKIR 482
            G IS +EF+  ++
Sbjct: 562 DGKISYEEFVAMMK 575


>02_04_0547 - 23786224-23786718
          Length = 164

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 15/57 (26%), Positives = 29/57 (50%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L R+F   D DG   + +EE    ++  G+ +++ E     ++ D +  G + +DEF
Sbjct: 9   LRRVFELFDRDGDGRITREELTESLERLGMPVHREELAATIARIDANGDGCVDMDEF 65


>05_04_0127 - 18262499-18263104
          Length = 201

 Score = 38.7 bits (86), Expect = 0.003
 Identities = 18/66 (27%), Positives = 31/66 (46%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           R+FR+ D +G   +++ E     +  G  +   E   +  + D+D  G ISL EF     
Sbjct: 58  RVFRKFDANGDGRISRAELAALFRSVGHAVTDDEVARMMQEADSDGDGYISLGEFAAISA 117

Query: 483 PPMSES 500
           PP  ++
Sbjct: 118 PPPGDA 123


>01_05_0049 + 17577358-17577993
          Length = 211

 Score = 38.3 bits (85), Expect = 0.005
 Identities = 21/69 (30%), Positives = 34/69 (49%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           L  IFR  D +G   L + E    ++  GL+ +  E + L  + DT+S+G I   EF+  
Sbjct: 65  LREIFRSFDRNGDGSLTQLELGSLLRSLGLKPSTDELDSLIQRADTNSNGLIEFSEFVAL 124

Query: 477 IRPPMSESR 503
           + P +   R
Sbjct: 125 VAPELLYDR 133



 Score = 35.9 bits (79), Expect = 0.025
 Identities = 17/55 (30%), Positives = 25/55 (45%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           R+F   D DG+  +   E  + + + G  L   E   +  + DTD  G IS  EF
Sbjct: 143 RLFNIFDRDGNGFITAAELAHSMAKLGHALTVKELTGMIKEADTDGDGRISFQEF 197


>08_02_1430 -
           27048055-27048408,27049674-27049841,27049927-27050042,
           27050153-27050305,27050850-27050993,27051052-27051211,
           27051332-27051970
          Length = 577

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 18/56 (32%), Positives = 30/56 (53%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           ++F  MD D +  L+ +E L G+   G  + + E   L    DTD +G++  DEF+
Sbjct: 420 QMFHHMDKDKNGHLSLDELLEGLHINGQPVPEPEIRMLLEAADTDGNGTLDCDEFV 475



 Score = 30.7 bits (66), Expect = 0.92
 Identities = 18/55 (32%), Positives = 25/55 (45%)
 Frame = +3

Query: 321 DDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
           D DG+  L+ +EF+          N       F+ FD D SG I LDE   ++ P
Sbjct: 462 DTDGNGTLDCDEFVTVSVHLKKMSNDEYLAAAFNYFDKDGSGFIELDELREEVGP 516


>02_05_0646 - 30598769-30599293
          Length = 174

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 3/64 (4%)
 Frame = +3

Query: 285 GILGLGRIFRRMDDDGSKLLNKEEFLYGIKET---GLELNKSEAEELFSQFDTDSSGSIS 455
           G+  L   F   D+DG+ ++  EE    ++     G++L   +  E+ +  D+D  G IS
Sbjct: 103 GLDALRAAFDEYDEDGNGVITAEELRRALRRLNLDGMDLTAEQCAEIVAAVDSDGDGVIS 162

Query: 456 LDEF 467
            DEF
Sbjct: 163 FDEF 166



 Score = 30.3 bits (65), Expect = 1.2
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 2/56 (3%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEF--LYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           R+FR  D DG  L++  E    YG        +  EAEE+ +  D D  G +S++E
Sbjct: 46  RVFRCFDTDGDGLISAAEMREFYG-------CSVDEAEEMVAAADRDGDGFVSIEE 94


>01_01_1223 + 9886709-9886784,9887566-9887935,9888028-9888097
          Length = 171

 Score = 37.1 bits (82), Expect = 0.011
 Identities = 18/58 (31%), Positives = 28/58 (48%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D D +  ++  E  + +   G +L   E EE+  + D D  G I+ DEF+
Sbjct: 86  LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVDGDGQINYDEFV 143



 Score = 32.3 bits (70), Expect = 0.30
 Identities = 14/54 (25%), Positives = 27/54 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL
Sbjct: 17  FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL 70


>07_03_0947 -
           22805419-22805571,22805736-22805966,22806161-22806328,
           22806425-22806540,22806853-22807005,22807241-22807384,
           22807584-22807707,22808126-22808689
          Length = 550

 Score = 36.7 bits (81), Expect = 0.014
 Identities = 15/61 (24%), Positives = 33/61 (54%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           + G+  +F +MD +   ++N +E   G+ + G ++  ++ + L    D D +GS+   EF
Sbjct: 378 VAGIKDMFEKMDLNKDNMINFDELKLGLHKLGHQMADADVQILMDAADVDGNGSLDYGEF 437

Query: 468 L 470
           +
Sbjct: 438 V 438


>01_06_1236 +
           35613123-35613816,35615809-35615952,35616032-35616184,
           35616572-35616687,35616800-35616967,35617647-35617707,
           35617772-35617824,35618278-35618508,35618600-35618749
          Length = 589

 Score = 36.7 bits (81), Expect = 0.014
 Identities = 18/62 (29%), Positives = 29/62 (46%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           L R F   D DG+  +  EE    + + G   +     ++  + DTD  G IS DEF+  
Sbjct: 493 LRRAFLFFDKDGNGYIEPEELREALVDDGAGDSMEVVNDILQEVDTDKDGKISYDEFVAM 552

Query: 477 IR 482
           ++
Sbjct: 553 MK 554


>01_06_1085 + 34414353-34414428,34416038-34416407,34416534-34416651
          Length = 187

 Score = 36.7 bits (81), Expect = 0.014
 Identities = 17/54 (31%), Positives = 29/54 (53%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F   D DG   +  +E    ++  G    ++E +++ S+ DTDS+G+I   EFL
Sbjct: 17  FSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMISEVDTDSNGNIEFKEFL 70



 Score = 36.7 bits (81), Expect = 0.014
 Identities = 21/71 (29%), Positives = 34/71 (47%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           L   FR  D D +  ++  E  + +   G  L   E  E+ S+ D D  G I+ +EF   
Sbjct: 86  LKEAFRVFDKDQNGFISATELRHVMANIGERLTDEEVGEMISEADVDGDGQINYEEF--- 142

Query: 477 IRPPMSESRRK 509
           ++  M++ RRK
Sbjct: 143 VKCMMAKKRRK 153


>08_02_1589 + 28070286-28070525,28072224-28072565
          Length = 193

 Score = 36.3 bits (80), Expect = 0.019
 Identities = 17/64 (26%), Positives = 32/64 (50%)
 Frame = +3

Query: 279 ASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISL 458
           A+    + RIF+R D +G   ++  E    ++  G   +  E + + ++ DTD  G I  
Sbjct: 3   AASSADMERIFKRFDTNGDGKISLSELTDALRTLG-STSADEVQRMMAEIDTDGDGFIDF 61

Query: 459 DEFL 470
           +EF+
Sbjct: 62  NEFI 65



 Score = 28.3 bits (60), Expect = 4.9
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = +3

Query: 393 NKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           + ++ E +F +FDT+  G ISL E    +R
Sbjct: 5   SSADMERIFKRFDTNGDGKISLSELTDALR 34


>03_05_1090 +
           30313176-30313292,30314162-30314236,30314938-30315181,
           30315701-30315787,30315832-30315995,30316587-30316689,
           30317751-30317908,30318025-30318105,30318192-30318344
          Length = 393

 Score = 36.3 bits (80), Expect = 0.019
 Identities = 16/62 (25%), Positives = 31/62 (50%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           L   F  +D D +  ++  E    +   G ++   E E++  + DTD  G ++ DEF+I 
Sbjct: 324 LKEAFEVLDKDQNGFISPTELRTVMTNLGEKMTDEEVEQMIREADTDGDGQVNYDEFVIM 383

Query: 477 IR 482
           ++
Sbjct: 384 MK 385



 Score = 35.5 bits (78), Expect = 0.032
 Identities = 19/63 (30%), Positives = 27/63 (42%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D +G   +  EE     +  GLE    E  ++  + DTD +G I   EFL  I   
Sbjct: 255 FLLFDKNGDGCITLEELAAVTRSLGLEPTDQELNDMMREVDTDGNGIIDFQEFLSLIARK 314

Query: 489 MSE 497
           M +
Sbjct: 315 MKD 317



 Score = 28.3 bits (60), Expect = 4.9
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 1/57 (1%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELN-KSEAEELFSQFDTDSSGSISLDE 464
           L  + R +D DG+ +++ +EFL  I     + +   E +E F   D D +G IS  E
Sbjct: 287 LNDMMREVDTDGNGIIDFQEFLSLIARKMKDGDGDEELKEAFEVLDKDQNGFISPTE 343


>07_03_1286 +
           25482632-25482685,25483948-25484145,25484242-25484464,
           25484762-25484958,25485150-25485237,25487103-25487197,
           25487585-25487705,25487795-25487831,25487924-25487951,
           25488175-25488327,25488666-25488768,25488868-25488932
          Length = 453

 Score = 35.9 bits (79), Expect = 0.025
 Identities = 15/53 (28%), Positives = 27/53 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           F   D D S  ++ +E    ++  G E+ + +  ++ +  D D SGSI  +EF
Sbjct: 317 FDLFDTDNSGTIDAKELNVAMRALGFEMTEEQINQMIADVDKDGSGSIDYEEF 369


>05_01_0448 + 3566151-3567380,3567877-3568188,3568318-3568455
          Length = 559

 Score = 35.9 bits (79), Expect = 0.025
 Identities = 21/75 (28%), Positives = 38/75 (50%)
 Frame = +3

Query: 249 ETRLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQF 428
           +T +   +  A+    + R FR +D +G   ++ EE    +++ G      +AEEL    
Sbjct: 438 QTGVPAAAAAAASAGNIERAFRLLDKNGDGRISMEELTELMEDLGA--GGKDAEELMRLL 495

Query: 429 DTDSSGSISLDEFLI 473
           D ++ GS+S DEF +
Sbjct: 496 DDNNDGSLSSDEFAL 510



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 10/21 (47%), Positives = 18/21 (85%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDDI 574
           +E+AF+ LDK GDG I+++++
Sbjct: 454 IERAFRLLDKNGDGRISMEEL 474


>01_07_0179 -
           41814886-41815074,41815172-41815222,41815365-41815469,
           41815852-41815945,41816056-41816150,41816581-41816700,
           41816737-41816832,41817272-41817569,41817777-41817853,
           41818932-41819447
          Length = 546

 Score = 35.9 bits (79), Expect = 0.025
 Identities = 17/55 (30%), Positives = 27/55 (49%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           R+FR+ D +G   +++ E     +  G      E   + ++ D D  G ISLDEF
Sbjct: 43  RVFRKFDANGDGRISRSELGALFESLGHAATDDELARMMAEADADGDGFISLDEF 97


>01_05_0628 - 23806901-23807650
          Length = 249

 Score = 35.5 bits (78), Expect = 0.032
 Identities = 17/57 (29%), Positives = 27/57 (47%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L   FR  D DG+  ++  E    +   G  +  +E  ++  + DTD  G IS +EF
Sbjct: 176 LAEAFRAFDRDGNGFISAAELARSMARMGHPICYAELTDMMREADTDGDGLISFEEF 232


>05_01_0450 + 3577928-3579526,3579695-3579832
          Length = 578

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 19/57 (33%), Positives = 31/57 (54%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           R F+ +D +G   ++ EE    +++ G      +AEEL    D +S GS+S DEF +
Sbjct: 475 RAFQLLDKNGDGRISMEELTEIMEDLGA--GGHDAEELMRLLDANSDGSLSSDEFAL 529



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 11/21 (52%), Positives = 18/21 (85%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDDI 574
           VE+AF+ LDK GDG I+++++
Sbjct: 473 VERAFQLLDKNGDGRISMEEL 493


>07_03_1738 -
           29141829-29141989,29142112-29142343,29142751-29142792,
           29143312-29143410,29143575-29143667,29143742-29143876,
           29144251-29144290,29144475-29144844,29146575-29146650
          Length = 415

 Score = 34.3 bits (75), Expect = 0.075
 Identities = 16/58 (27%), Positives = 28/58 (48%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D D +  ++  E  + +   G +L   E +E+  + D D  G I+ +EF+
Sbjct: 86  LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFV 143



 Score = 32.3 bits (70), Expect = 0.30
 Identities = 14/54 (25%), Positives = 27/54 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL
Sbjct: 17  FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL 70


>05_07_0229 - 28537784-28538296
          Length = 170

 Score = 34.3 bits (75), Expect = 0.075
 Identities = 17/54 (31%), Positives = 23/54 (42%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +FR  D DG+  ++  E    +   G  L   E   +    DTD  G IS  EF
Sbjct: 102 VFRAFDRDGNGFISAAELARSMARLGQPLTFEELTRMMRDADTDGDGVISFKEF 155


>05_05_0309 - 23987669-23988042,23989485-23989560
          Length = 149

 Score = 34.3 bits (75), Expect = 0.075
 Identities = 16/58 (27%), Positives = 28/58 (48%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D D +  ++  E  + +   G +L   E +E+  + D D  G I+ +EF+
Sbjct: 86  LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFV 143



 Score = 32.7 bits (71), Expect = 0.23
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMAKK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>03_02_0817 + 11492699-11492774,11493605-11493978
          Length = 149

 Score = 34.3 bits (75), Expect = 0.075
 Identities = 16/58 (27%), Positives = 28/58 (48%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D D +  ++  E  + +   G +L   E +E+  + D D  G I+ +EF+
Sbjct: 86  LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFV 143



 Score = 32.3 bits (70), Expect = 0.30
 Identities = 14/54 (25%), Positives = 27/54 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL
Sbjct: 17  FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL 70


>02_01_0763 -
           5665010-5665202,5665285-5665375,5665460-5666245,
           5667745-5668225
          Length = 516

 Score = 34.3 bits (75), Expect = 0.075
 Identities = 16/59 (27%), Positives = 32/59 (54%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L L RIF+ +D + +  +  EE  + + + G+E++  E        D D++G I+ +E+
Sbjct: 131 LELYRIFQAIDVEHNGCILPEELWHALVKAGIEIDDEELARFVEHVDKDNNGIITFEEW 189


>01_01_1156 - 9194477-9194485,9194801-9195156,9197783-9197858
          Length = 146

 Score = 34.3 bits (75), Expect = 0.075
 Identities = 16/58 (27%), Positives = 28/58 (48%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D D +  ++  E  + +   G +L   E +E+  + D D  G I+ +EF+
Sbjct: 86  LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFV 143



 Score = 32.3 bits (70), Expect = 0.30
 Identities = 14/54 (25%), Positives = 27/54 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL
Sbjct: 17  FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL 70


>04_04_0419 +
           25086456-25086768,25087302-25087369,25087458-25087681,
           25087929-25088012,25088593-25088806,25089252-25089428,
           25089526-25089645,25089865-25089991,25090104-25090130,
           25090526-25091007
          Length = 611

 Score = 33.9 bits (74), Expect = 0.099
 Identities = 17/53 (32%), Positives = 28/53 (52%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           F   D +G +L++  E+++ +  T L + +S     F  FD D SG I  +EF
Sbjct: 187 FMLFDTNGDRLISFAEYIFFV--TLLSIPESSFSAAFKMFDVDHSGEIDKEEF 237


>12_01_0207 -
           1559491-1559544,1559806-1560161,1560244-1560363,
           1561523-1561568,1561741-1561858,1561981-1562093,
           1562586-1562658,1562743-1562882,1563005-1563075,
           1563228-1563396,1563594-1563659,1564052-1564150,
           1564271-1564444,1564720-1564798,1564901-1565007,
           1565391-1565435
          Length = 609

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 16/54 (29%), Positives = 26/54 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F   D DG   +  +E    +   G    ++E +++  + D D SGSI  +EFL
Sbjct: 465 FNLFDKDGDGTITSKELGTVMGSLGQSPTEAELKKMVEEVDADGSGSIEFEEFL 518



 Score = 29.9 bits (64), Expect = 1.6
 Identities = 14/54 (25%), Positives = 26/54 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           FR  D D +  +  +E  + +      L+  E  ++  + D+D  G I+ +EFL
Sbjct: 538 FRVFDKDQNGFITPDELRHVMANLSDPLSDDELADMLHEADSDGDGQINYNEFL 591


>05_05_0298 -
           23926266-23926442,23926573-23926632,23926822-23927029,
           23927471-23927703,23928806-23928860,23928943-23929649
          Length = 479

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 6/71 (8%)
 Frame = +3

Query: 273 RGASGILGLGRIFRRMDDDGSKLLNKEEF---LYGIKETGLELNKSEA---EELFSQFDT 434
           R + G   L   F+  D D S  ++KEE    L  + E  L  + +E    +E+F Q D 
Sbjct: 388 RNSRGDDALRLCFQMYDADRSGCISKEELASMLRALPEECLPGDITEPGKLDEVFDQMDA 447

Query: 435 DSSGSISLDEF 467
           DS G ++ DEF
Sbjct: 448 DSDGKVTFDEF 458


>12_01_0398 -
           3143745-3143777,3144045-3144126,3144863-3144975,
           3145072-3145152,3145517-3145569,3146042-3146150,
           3147512-3147571,3147689-3147771,3147913-3148086,
           3148133-3148172
          Length = 275

 Score = 32.7 bits (71), Expect = 0.23
 Identities = 18/48 (37%), Positives = 28/48 (58%)
 Frame = +3

Query: 324 DDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           DDG  L+NKEEF   + +T  + +   A+ +F  FDT  +G +  +EF
Sbjct: 93  DDG--LINKEEFQLALFKTNRK-DSMFADRVFDLFDTKHNGILGFEEF 137


>11_06_0212 -
           21319441-21319498,21319737-21319867,21319944-21320033,
           21320141-21320298,21320646-21320721
          Length = 170

 Score = 32.7 bits (71), Expect = 0.23
 Identities = 14/64 (21%), Positives = 32/64 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D +    +++EE    +   G+  ++ + +++    D D +G+I  DEFL  ++  
Sbjct: 17  FSLFDKNNDGCISREELATVLTRLGMAPSQEDLQDMIVAVDEDGNGTIEFDEFLAIMKKK 76

Query: 489 MSES 500
           + E+
Sbjct: 77  LYEN 80



 Score = 30.7 bits (66), Expect = 0.92
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 4/53 (7%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELNKSEAEE----LFSQFDTDSSGSISLDE 464
           +D+DG+  +  +EFL  +K+   E +K + EE     F  FD D +G IS +E
Sbjct: 56  VDEDGNGTIEFDEFLAIMKKKLYENDKGDDEEELRKAFRIFDKDDNGFISRNE 108


>11_01_0203 - 1610086-1610192,1610620-1610669,1610888-1611348
          Length = 205

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 15/54 (27%), Positives = 27/54 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           FR  D D +  +  +E  + +   G  L+  E  ++  + D+D  G I+ +EFL
Sbjct: 95  FRVFDKDQNGFITPDELRHVMANLGDPLSDDELADMLHEADSDGDGQINYNEFL 148



 Score = 28.7 bits (61), Expect = 3.7
 Identities = 17/74 (22%), Positives = 34/74 (45%)
 Frame = +3

Query: 249 ETRLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQF 428
           ET +  +++  + +LG   I        +  +  +E    +   G    ++E +++  + 
Sbjct: 2   ETVIQSINQSIACVLGRRSINESRRKCNAGTITSKELGTVMGSLGQSPTEAELKKMVEEV 61

Query: 429 DTDSSGSISLDEFL 470
           D D SGSI  +EFL
Sbjct: 62  DADGSGSIEFEEFL 75


>06_03_1213 - 28463774-28464286
          Length = 170

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 17/63 (26%), Positives = 29/63 (46%)
 Frame = +3

Query: 282 SGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLD 461
           S I  L   F+  D D   L+   E    +   GL+  + E  ++ ++ D D  G +S++
Sbjct: 27  SYISSLVEAFQAFDSDNDGLVTAPELRGLLASLGLDKPEHEVRDMLARADADRDGKLSVE 86

Query: 462 EFL 470
           E L
Sbjct: 87  ELL 89


>06_03_0691 +
           23552437-23552914,23555168-23555953,23556045-23556135,
           23556214-23556406
          Length = 515

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 16/59 (27%), Positives = 31/59 (52%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L L RIF+ +D + +  +  EE    + + G+E++  E        D D++G I+ +E+
Sbjct: 130 LELYRIFQAIDVEHNGCILPEELWDALVKAGIEIDDEELARFVEHVDKDNNGIITFEEW 188


>05_01_0445 +
           3547176-3547577,3548625-3549557,3550246-3550524,
           3550624-3550752,3550813-3550869
          Length = 599

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 18/55 (32%), Positives = 30/55 (54%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           R F ++D +G   ++ EE    +++ G      +A+EL    D +S GS+S DEF
Sbjct: 480 RAFCQLDKNGDGRISIEELTEVMEDLGA--GGKDAKELMHLLDANSDGSLSSDEF 532



 Score = 27.5 bits (58), Expect = 8.6
 Identities = 13/32 (40%), Positives = 22/32 (68%)
 Frame = +2

Query: 479 PSSHVGIAS*IVEQAFKKLDKTGDGAITIDDI 574
           P+S  G ++    +AF +LDK GDG I+I+++
Sbjct: 468 PASDQGDSN-CTNRAFCQLDKNGDGRISIEEL 498


>04_04_0351 + 24615858-24616448
          Length = 196

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/57 (22%), Positives = 28/57 (49%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L R+F   D +G   + +EE    + + G+ +   E   + ++ D +  G + ++EF
Sbjct: 39  LARVFELFDRNGDGRITREELEDSLGKLGIPVPADELAAVIARIDANGDGCVDVEEF 95


>01_07_0217 + 42072475-42072915
          Length = 146

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 1/56 (1%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKET-GLELNKSEAEELFSQFDTDSSGSISLDEF 467
           R+F   D D    ++  E    +K   G +++  EAE L S  DTD  G +  +EF
Sbjct: 10  RVFSAFDRDADGKISAAELRLCMKAALGEDMSAEEAEALVSSADTDDDGLLDEEEF 65



 Score = 29.9 bits (64), Expect = 1.6
 Identities = 16/60 (26%), Positives = 25/60 (41%)
 Frame = +3

Query: 294 GLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           GL   FR  + +G   +        + + G      E + +  +FD D  G IS +EF I
Sbjct: 83  GLMEAFRMYEMEGEGRITPASLKRMLSKLGSHQGIEECQTMICRFDLDGDGVISFEEFKI 142


>12_02_0370 +
           18139557-18140469,18140561-18140704,18140804-18140956,
           18141032-18141147,18141231-18141398,18142110-18142334,
           18142458-18142577
          Length = 612

 Score = 31.9 bits (69), Expect = 0.40
 Identities = 16/54 (29%), Positives = 26/54 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F+  D DGS  +  +E      E G+E      E++  + D D+ G I  +EF+
Sbjct: 532 FQYFDKDGSGYITSDELQQACDEFGIE--DVRLEDMIGEVDQDNDGRIDYNEFV 583


>06_03_0724 - 23890715-23890929,23891311-23891506
          Length = 136

 Score = 31.9 bits (69), Expect = 0.40
 Identities = 12/56 (21%), Positives = 29/56 (51%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           IF + D+D +  ++K+E  +  ++  +   + E  +LF   D +    +  +EF++
Sbjct: 61  IFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINDLFEACDINEDMGMKFNEFIV 116


>03_06_0394 +
           33592780-33593310,33593890-33594013,33594233-33594376,
           33594463-33594615,33594973-33595088,33595253-33595420,
           33595514-33595744,33596229-33596378
          Length = 538

 Score = 31.9 bits (69), Expect = 0.40
 Identities = 16/55 (29%), Positives = 29/55 (52%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +F +MD   +  L  E+F  GI++ G ++  S+ + L    D D +G +   EF+
Sbjct: 373 MFDKMDVSKNGQLTFEDFKAGIRKLGNQMPDSDLKILMDAADIDKNGILDYQEFV 427


>12_02_1027 + 25496311-25496811
          Length = 166

 Score = 31.5 bits (68), Expect = 0.53
 Identities = 16/54 (29%), Positives = 23/54 (42%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F   D DG   +  EE    ++  G    + E  E+    D D +G+I   EFL
Sbjct: 20  FAFFDKDGDGCITLEELDTVVRSLGQTPTREELAEMIRDVDVDGNGTIEFAEFL 73


>08_02_1569 -
           27924930-27925034,27925149-27925167,27925271-27925490,
           27925925-27925971,27926502-27927025
          Length = 304

 Score = 31.5 bits (68), Expect = 0.53
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 4/69 (5%)
 Frame = +3

Query: 276 GASGILG--LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFD--TDSS 443
           G   +LG  +  IF R D DGS  + K+E    ++  G  +  S  E L + ++    S 
Sbjct: 195 GLISVLGGNIQGIFDRYDRDGSGKIEKDELREALRSLGYAVPPSVLELLIANYNNGVSSR 254

Query: 444 GSISLDEFL 470
           G++  D F+
Sbjct: 255 GALDFDNFV 263


>03_05_0739 + 27271404-27271988,27272265-27272411
          Length = 243

 Score = 31.5 bits (68), Expect = 0.53
 Identities = 21/87 (24%), Positives = 40/87 (45%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DGS  +++ E    + +     + +  + +  + DTD  G IS +EF+  ++  
Sbjct: 152 FLFFDKDGSGYIDRAELADALADDSGHADDAVLDHILREVDTDKDGRISYEEFVAMMK-- 209

Query: 489 MSESRRKL*NKHSRSLTRLVTVQSQLM 569
                RK   ++SR   R  T+ + L+
Sbjct: 210 SGTDWRKASRQYSRE--RFKTLSNSLI 234


>07_03_0043 -
           12741661-12741816,12741980-12742153,12742870-12742932,
           12744107-12744214,12744303-12744418,12745188-12745314,
           12746423-12746592,12747409-12747487,12747558-12747669,
           12748064-12748154,12748425-12748534,12748536-12748666,
           12749557-12749817
          Length = 565

 Score = 31.1 bits (67), Expect = 0.70
 Identities = 21/65 (32%), Positives = 29/65 (44%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F + D DG   +  +E      +TGL   K   + L  + D D  G ISLDEF   ++  
Sbjct: 496 FDKFDVDGDGYITSDELRM---QTGL---KGSIDPLLEEADIDRDGKISLDEFRRLLKTA 549

Query: 489 MSESR 503
              SR
Sbjct: 550 SMSSR 554


>02_04_0593 +
           24177897-24178182,24178442-24178509,24178617-24178840,
           24179221-24179304,24180183-24180396,24181242-24181418,
           24181507-24181626,24181854-24181998,24182055-24182065,
           24182222-24182314
          Length = 473

 Score = 31.1 bits (67), Expect = 0.70
 Identities = 17/53 (32%), Positives = 27/53 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           F   D +G  L++  E+++ +  T L + +S     F  FD D SG I  +EF
Sbjct: 178 FMLFDTNGDGLISFAEYIFFV--TLLSIPESSFNIAFKMFDLDHSGEIDKEEF 228



 Score = 27.9 bits (59), Expect = 6.5
 Identities = 13/41 (31%), Positives = 23/41 (56%)
 Frame = +3

Query: 384 LELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPPMSESRR 506
           ++L     + +F  FD +  GS+S DEFL  ++   S+ R+
Sbjct: 395 VDLTDKVVDVIFLVFDANRDGSLSADEFLRALQRRESDIRQ 435


>01_07_0216 - 42071041-42071496
          Length = 151

 Score = 31.1 bits (67), Expect = 0.70
 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 1/57 (1%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKET-GLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           R+F   D DG   ++  E    +K + G ++   E + L +  DTD  G +  +EF+
Sbjct: 9   RVFGSFDQDGDGKISATELRLCVKASLGEDMPDEEVQALMALADTDGDGLLDEEEFV 65


>09_02_0362 +
           7860088-7860197,7861606-7861636,7861738-7861801,
           7861922-7862052,7863575-7863784,7863891-7863956,
           7864868-7865075,7866270-7866325,7866406-7867128,
           7868246-7868299,7868667-7868695,7869501-7869585,
           7870032-7870202,7870246-7870827
          Length = 839

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 15/46 (32%), Positives = 25/46 (54%)
 Frame = -3

Query: 209 FCISSSSWTEPADIGLCHATELSISAFTFGEFS*LKQAAIEALLIL 72
           FC+  S WT+  ++ L   + +S S   F E + + +   EAL+IL
Sbjct: 70  FCVQRSGWTKDMNVFLSWLSGISFSGGGFSEAA-ISEGLAEALMIL 114


>04_04_0934 +
           29504806-29505532,29506059-29506202,29506291-29506443,
           29506589-29506704,29507180-29507347,29507716-29507778,
           29507827-29508051,29508472-29508594
          Length = 572

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 22/52 (42%), Positives = 27/52 (51%), Gaps = 4/52 (7%)
 Frame = +3

Query: 321 DDDGSKLLNKEEFLYGIKETGLELNKSEAEE----LFSQFDTDSSGSISLDE 464
           D D S  ++  EF+       L LNK E EE     FS FD D SG I++DE
Sbjct: 459 DIDNSGTIDYIEFIAAT----LHLNKLEREEHLVAAFSYFDKDGSGYITVDE 506


>04_04_0433 +
           25163111-25163471,25163943-25164154,25164420-25164701,
           25164794-25164916,25165511-25165664,25165754-25165965,
           25166143-25166212,25166294-25166424
          Length = 514

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 16/51 (31%), Positives = 29/51 (56%)
 Frame = +3

Query: 330 GSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           G K++++EE +  IK   ++  K    ++     TDS  ++SLDE L ++R
Sbjct: 202 GRKVVSREEAIMHIK-AAVDARKESGSDIVIVARTDSRQALSLDEALWRVR 251


>01_05_0422 -
           22018579-22018698,22019548-22019644,22019744-22019908,
           22022274-22022339,22022441-22022540,22022662-22023304
          Length = 396

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 11/62 (17%)
 Frame = +3

Query: 312 RRMDDDGSKLLNKEEFLYGIKE--TGLEL---------NKSEAEELFSQFDTDSSGSISL 458
           R+ D DG   LN EE+ +G+ +   G +          N + A+E FS+ D DS G IS 
Sbjct: 270 RQRDKDGDGKLNFEEYFHGLHDHIHGYDYENADISHIGNNTVAKERFSKLDKDSDGFISE 329

Query: 459 DE 464
            E
Sbjct: 330 HE 331


>05_03_0020 - 7433619-7434089
          Length = 156

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 13/57 (22%), Positives = 26/57 (45%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L   FR  D D +  ++  E    +++ G + + ++   +    D D  G ++ DEF
Sbjct: 89  LREAFRMYDADSNGKISARELHRVLRQLGDKCSVADCSRMIRSVDADGDGCVNFDEF 145


>02_01_0738 +
           5501894-5501978,5502130-5502369,5502880-5503079,
           5503653-5503827,5503923-5504038
          Length = 271

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 11/56 (19%), Positives = 30/56 (53%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           IF++ D+D +  ++++E  +  ++  +     E ++LF   D   +  +  +EF++
Sbjct: 104 IFQQFDEDSNGEIDQQELKHCFQKLDISFTDEEIKDLFQACDIYENMGMKFNEFIV 159


>01_07_0252 -
           42296138-42296281,42296527-42296613,42297043-42297135,
           42297267-42297341,42297480-42297575,42297987-42298133,
           42298225-42298296,42298912-42298959,42299507-42299607,
           42300226-42300337,42300506-42300590,42300693-42300848,
           42300956-42301047,42301155-42301238,42301676-42301726,
           42302227-42302295,42302417-42302476,42303305-42303535
          Length = 600

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 17/48 (35%), Positives = 27/48 (56%)
 Frame = +3

Query: 321 DDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           ++DG   L+  EF   +K  G +L  ++ EELF Q D +  G + +DE
Sbjct: 140 NEDGE--LSLSEFSDLMKAFGNKLAVAKIEELFRQADKNGDGIVDMDE 185


>01_07_0215 - 42066753-42067208
          Length = 151

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 1/56 (1%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKET-GLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +F   D DG   ++  E    +K T G E++  EA +L +  D D  G +   EF+
Sbjct: 15  LFATFDHDGDGRISAAELRLCMKTTLGEEVSDEEAGQLVASVDADGDGLLCEAEFV 70


>12_01_0249 + 1850443-1851030
          Length = 195

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 21/76 (27%), Positives = 32/76 (42%), Gaps = 1/76 (1%)
 Frame = +3

Query: 243 SGETRLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLEL-NKSEAEELF 419
           +GE  L  ++  A+    L   F   D DG   ++ EE    +   G EL +  +   + 
Sbjct: 111 AGELVLEEIAAAAADEGELKETFAVFDADGDGRISAEELRAVLASLGDELCSVDDCRRMI 170

Query: 420 SQFDTDSSGSISLDEF 467
              DTD  G +  DEF
Sbjct: 171 GGVDTDGDGFVCFDEF 186


>11_01_0250 + 1924261-1924848
          Length = 195

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 21/76 (27%), Positives = 32/76 (42%), Gaps = 1/76 (1%)
 Frame = +3

Query: 243 SGETRLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLEL-NKSEAEELF 419
           +GE  L  ++  A+    L   F   D DG   ++ EE    +   G EL +  +   + 
Sbjct: 111 AGELVLEEIAAAAADEGELKETFAVFDADGDGRISAEELRAVLASLGDELCSVDDCRRMI 170

Query: 420 SQFDTDSSGSISLDEF 467
              DTD  G +  DEF
Sbjct: 171 GGVDTDGDGFVCFDEF 186


>10_08_0427 +
           17828007-17828570,17829788-17829904,17830319-17830384,
           17831466-17831572,17831939-17832017,17832861-17833574,
           17834040-17834148,17834263-17834429,17834876-17834950,
           17835025-17835117,17835202-17835294
          Length = 727

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 19/59 (32%), Positives = 30/59 (50%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKI 479
           +IF +M D+  +  N E+ +   ++ G   N  EAE   ++ + D SG  S  E LI I
Sbjct: 406 KIFDQMSDEDDENDNPEDEIESSEDIGDGDNVEEAEAASAEDNVDESGDESDIEALISI 464


>12_01_0771 - 7013343-7013861
          Length = 172

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 10/25 (40%), Positives = 17/25 (68%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDDIKGCL 586
           + +AF   D+ GDG IT+D+++  L
Sbjct: 100 MREAFNVFDQNGDGFITVDELRSVL 124


>11_01_0656 -
           5301048-5301441,5301779-5301976,5302056-5302228,
           5302691-5302935,5303014-5303191,5303578-5303760,
           5303858-5303962,5304621-5304758,5304846-5305802
          Length = 856

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 18/58 (31%), Positives = 31/58 (53%)
 Frame = +3

Query: 369 IKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPPMSESRRKL*NKHSRSLTR 542
           I+ +  E   SE + +F++  T  +G ++  EF +  R PMSE   +    HS+ LT+
Sbjct: 604 IEVSSNEYEPSEKDVIFAEGVTQGNG-LAFIEFALDDRSPMSEPYIENPEAHSQPLTK 660


>09_04_0720 -
           19720844-19720975,19721582-19721809,19722108-19722290,
           19722361-19722476,19722684-19722836,19722977-19723120,
           19723257-19723380,19723548-19724479,19725245-19725422
          Length = 729

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = +3

Query: 321 DDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           D DG+  L+ EEF+  +       N+    + F  FD D +G I ++E +
Sbjct: 612 DIDGNGTLDCEEFVTVLLHIKKMSNEEYLPKAFKFFDKDGNGFIEMEELM 661


>09_04_0555 + 18498442-18498864
          Length = 140

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 10/23 (43%), Positives = 17/23 (73%)
 Frame = +3

Query: 414 LFSQFDTDSSGSISLDEFLIKIR 482
           LF++FD D SG + L+EF  +++
Sbjct: 80  LFARFDRDGSGGVDLEEFRAEMK 102


>01_07_0178 + 41810795-41811409
          Length = 204

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = +2

Query: 518 QAFKKLDKTGDGAITIDDIKGCLL 589
           +AFK  D  GDG IT ++++G ++
Sbjct: 125 EAFKVFDADGDGRITAEELRGVMV 148


>09_04_0557 + 18503380-18503793
          Length = 137

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 19/86 (22%), Positives = 41/86 (47%), Gaps = 2/86 (2%)
 Frame = +3

Query: 240 SSGETRLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNK--SEAEE 413
           SS + R   L     G+L    + + +     ++L K    +G+ E  +  ++       
Sbjct: 23  SSVDGRFAALDTNRDGLLSYSEMAKELMS--LRVLEKH---FGVDEAAMSSDELVEMYRG 77

Query: 414 LFSQFDTDSSGSISLDEFLIKIRPPM 491
           L+++FD D +G++ L+EF  +++  M
Sbjct: 78  LYARFDHDGNGTVDLEEFRAEMKEVM 103


>01_05_0457 +
           22423998-22424039,22424139-22424415,22424540-22424622,
           22425378-22425437,22425610-22425718,22425805-22425857,
           22425953-22426033,22426125-22426237,22426421-22426475
          Length = 290

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 23/101 (22%), Positives = 42/101 (41%), Gaps = 1/101 (0%)
 Frame = +3

Query: 213 CSCYDTSY*SSGETRLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKE-TGLE 389
           CS  D       E +L      +   L L R+F   D+  + ++  +EF++ +     L 
Sbjct: 124 CSIIDDGLIHKEELQLALFKTPSGQNLFLDRVFDLFDEKKNGVIEFDEFIHALSVFHPLA 183

Query: 390 LNKSEAEELFSQFDTDSSGSISLDEFLIKIRPPMSESRRKL 512
             + +    F  +D   +G I  +E +  +   +SES  KL
Sbjct: 184 PLEDKINFAFRLYDLRQTGFIEREEVMQMVIAILSESDMKL 224


>11_01_0270 + 2037053-2037108,2037294-2037408
          Length = 56

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 11/22 (50%), Positives = 14/22 (63%)
 Frame = +3

Query: 402 EAEELFSQFDTDSSGSISLDEF 467
           + E++   FD D  G ISLDEF
Sbjct: 32  DCEKMIHVFDKDGDGRISLDEF 53


>09_04_0553 + 18493865-18494281
          Length = 138

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 9/23 (39%), Positives = 18/23 (78%)
 Frame = +3

Query: 414 LFSQFDTDSSGSISLDEFLIKIR 482
           LF++FD D +G++ L+EF  +++
Sbjct: 79  LFARFDRDGNGAVDLEEFRAEMK 101


>06_01_0982 +
           7627420-7628141,7628190-7628643,7629167-7629823,
           7629975-7630469
          Length = 775

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 24/91 (26%), Positives = 38/91 (41%), Gaps = 3/91 (3%)
 Frame = +1

Query: 247 EKLACFACPEVLQGSWDLEEFSVAWMMMEVNY*TKKNS---FMASRKQGWNLIKVKPKNS 417
           +K  C A  + L  SW  +EF   W  M   Y  + N     +   +Q W  + V   + 
Sbjct: 405 DKALCDAFNDCLDNSWTEQEFDAKWDAMLTTYHLQDNEHFRHLWEMRQCW--VPVYFMHC 462

Query: 418 SVNSTQTVVAQSVLMNSLLKSVLPCRNRVVN 510
                QT  A+S   N++LK  +  +N + N
Sbjct: 463 FFPFLQT-TARSEGFNAVLKRYVNPQNSIYN 492


>03_06_0239 -
           32578231-32578353,32578431-32578655,32579081-32579248,
           32579331-32579446,32579540-32579692,32579779-32579922,
           32580775-32581576
          Length = 576

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 15/39 (38%), Positives = 23/39 (58%)
 Frame = +3

Query: 348 KEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           K+  L  I E+  E   +  +E+F   DTD+SG I+L+E
Sbjct: 400 KKMALRVIAESLSEEEIAGLKEMFKMLDTDNSGHITLEE 438


>01_06_1718 -
           39408179-39408427,39409102-39409217,39409460-39409603,
           39409700-39410930,39411213-39411494
          Length = 673

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 17/50 (34%), Positives = 24/50 (48%)
 Frame = +1

Query: 121 PKVKAEMESSVAWHRPMSAGSVQEEELMQKSARAMTQATDPLEKLACFAC 270
           PK++ E E +   H    A  V EE+  +K  R   + +DP  K AC  C
Sbjct: 8   PKIEQE-EGNADSHGKEKADVVHEEKT-EKVKRRRKRVSDPQRKKACVDC 55


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,792,633
Number of Sequences: 37544
Number of extensions: 291192
Number of successful extensions: 1002
Number of sequences better than 10.0: 80
Number of HSP's better than 10.0 without gapping: 880
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 994
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1423789920
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).